[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69327.1
DDBJ      :             putative transmenmbrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  211/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
d.21.1
:357 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->315 3g7kB PDBj 1e-41 37.5 %
:RPS:PDB   3->260 3ejxD PDBj 1e-10 13.6 %
:RPS:SCOP  1->157 2h9fA1  d.21.1.4 * 3e-61 49.0 %
:RPS:SCOP  174->315 2h9fA2  d.21.1.4 * 9e-27 21.3 %
:RPS:PFM   3->310 PF04303 * PrpF 3e-55 49.5 %
:HMM:PFM   2->343 PF04303 * PrpF 5.5e-97 44.8 337/371  
:BLT:SWISS 1->315 YBHH_SHIFL 2e-73 46.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69327.1 GT:GENE BAC69327.1 GT:PRODUCT putative transmenmbrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1983493..1984566) GB:FROM 1983493 GB:TO 1984566 GB:DIRECTION - GB:PRODUCT putative transmenmbrane protein GB:PROTEIN_ID BAC69327.1 LENGTH 357 SQ:AASEQ MLMRGGTSKGAYFLAEDLPADAGARDDLLLRVMGSPDPRQIDGLGGAHPLTSKVAVVSVSADPEADVGYLFLQVGVDTAQVTDRQNCGNLLAGVGPFAVERGLVAPGDAETSVRIRMLNTGDLAVATFPTPGGRVDYTGSAEISGVPGTAAPVVIEFPPGGSPLLPTGLARDVVAGTPVTCVDNGMPTVLIAASSLNVKGYEDPKDLEEDVALADRLRAIRLEAGRLMGLGDVDGTTVPKLSLLAPPLHGGAIMTRTFIPVRCHTSIGVLGAASVAAGLRVEGGVGQDLARLPAHGDRLRIEHPTGFLDLETSIEHGAAGAVPVARRTAVVRTARKIFDGTVFPRSAATAPTPARHS GT:EXON 1|1-357:0| BL:SWS:NREP 1 BL:SWS:REP 1->315|YBHH_SHIFL|2e-73|46.5|314/350| SEG 158->169|ppggspllptgl| SEG 268->279|gvlgaasvaagl| SEG 317->335|gaagavpvarrtavvrtar| SEG 347->354|aataptpa| BL:PDB:NREP 1 BL:PDB:REP 1->315|3g7kB|1e-41|37.5|315/387| RP:PDB:NREP 1 RP:PDB:REP 3->260|3ejxD|1e-10|13.6|213/301| RP:PFM:NREP 1 RP:PFM:REP 3->310|PF04303|3e-55|49.5|307/371|PrpF| HM:PFM:NREP 1 HM:PFM:REP 2->343|PF04303|5.5e-97|44.8|337/371|PrpF| RP:SCP:NREP 2 RP:SCP:REP 1->157|2h9fA1|3e-61|49.0|157/182|d.21.1.4| RP:SCP:REP 174->315|2h9fA2|9e-27|21.3|141/209|d.21.1.4| OP:NHOMO 324 OP:NHOMOORG 255 OP:PATTERN -------------------------------------------------------------------- --------------------------------------12-1----------121-----------11-----------------------------------------------------------------------------------------------------------------------------1--------1------1---11----------------------------------------------------------------------------------------------------------------------------------------------------1------------1----------2-----1-111-------------------111--211---11---11---------22-----------1----1---------------------------------11--122211111111111111121111-11111122--1111--11221-12-------21-111111----1-1-------------------------------1-----------------------------111112111111111111111111111----1--------1---1--1111111111-11111111--111--11-1121---------------------1-1-111------------------1----------1-22---1-----------11111111112-11211312132431111-----11-------111111111121222222221111----------------------------------------------------------- --------------1232111114332------1111111111-----13223222211---1--------------------------131311-------2-------------------------------------------------------------------------------------11--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 315 STR:RPRED 88.2 SQ:SECSTR EEEEETTEEEEEEEEEcTTcccccccHHHHHHHHcccTTTcccccEEHHccccEEEEEEEccTTccEEEEEEETTcccccEEcccccHHHHHHHHHHHHHHTTccccEcEEcEccEEETTEEEEEEEEEETTEEEcTTccEEEEcccccccGGGTTcccccccTTccccEEEEETTEEEEEEEcccEEEEEcccTTcccccGGGccHHHHHHHHHTcTTccccGGGHHHHccTTccEEEEEEEEEEEEETTEEEEEEEcTTcccccccHHHHHHHHHHHHcTTcHHHHHccccTTccEEEEEETTEEEEEEEEEE########################################## DISOP:02AL 291-300, 351-357| PSIPRED cEEEccccHHHEEEHHHccccHHHHHHHHHHHHccccccEEcccccccccccEEEEEcccccccccEEEEEEEEEccccEEEccccHHHHHHHHHHHHHHcccccccccEEEEEEEEEccccEEEEEEEccccEEEEcccEEEccccccccEEEEEEcccccccccccccccEEccEEEEEEEccccEEEEEHHHccccccccHHHHcccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHcccccccEEEEEccccEEEEEEEEcccccccccEEEEEEEEEEEEEHHEEEEEcccccccccccccc //