[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69329.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  50/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.134.1
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->242 1uanB PDBj 5e-09 31.7 %
:RPS:PDB   11->245 3dfiA PDBj 8e-14 20.3 %
:RPS:SCOP  14->242 1uanA  c.134.1.1 * 1e-38 28.2 %
:HMM:SCOP  9->248 1q74A_ c.134.1.1 * 5.1e-55 36.7 %
:RPS:PFM   14->141 PF02585 * PIG-L 1e-15 44.4 %
:HMM:PFM   14->141 PF02585 * PIG-L 6.3e-25 40.3 124/128  
:HMM:PFM   171->224 PF07258 * HCaRG 0.00086 20.4 54/178  
:BLT:SWISS 11->207 DCHI_PYRKO 5e-07 28.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69329.1 GT:GENE BAC69329.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1985297..1986046) GB:FROM 1985297 GB:TO 1986046 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF02585: Uncharacterised LmbE-like protein, COG2120 GB:PROTEIN_ID BAC69329.1 LENGTH 249 SQ:AASEQ MTHGNAPATPRSTLVITAHAGDFVWRAGGAIALAASRGEKVTIACLTFGERGESAKAWREGKSLEEIKGIRREEAEKAAATLGAEVVFFDAGDYPLLATPELTDRLVAVHRQAQPDVVLTHPLDDPYNGDHPAAARMALDARVLAQAIGYPAPGEIIGAPPVFFFEPHQPEMCGFKPEVLLDITEVWETKRKAMECLAAQQHLWDYYTDLGKRRGVQLKRNAGPNLGLPHATYAEAYMRPYPQVTGELA GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 11->207|DCHI_PYRKO|5e-07|28.5|186/267| BL:PDB:NREP 1 BL:PDB:REP 14->242|1uanB|5e-09|31.7|202/219| RP:PDB:NREP 1 RP:PDB:REP 11->245|3dfiA|8e-14|20.3|227/242| RP:PFM:NREP 1 RP:PFM:REP 14->141|PF02585|1e-15|44.4|124/129|PIG-L| HM:PFM:NREP 2 HM:PFM:REP 14->141|PF02585|6.3e-25|40.3|124/128|PIG-L| HM:PFM:REP 171->224|PF07258|0.00086|20.4|54/178|HCaRG| RP:SCP:NREP 1 RP:SCP:REP 14->242|1uanA|1e-38|28.2|206/220|c.134.1.1| HM:SCP:REP 9->248|1q74A_|5.1e-55|36.7|229/297|c.134.1.1|1/1|LmbE-like| OP:NHOMO 60 OP:NHOMOORG 57 OP:PATTERN ----1-1---------1----------1----------------------------11---------- --1--------------------------------------------------------------1-1--------------1-------------------------1------------------1-------------11111-----------------------1---------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1----1------1-----------1----------------------------------1------1--111------------------------------------------------------------------11-1------1--------------------1---------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------------1----------11111111111----------------1--------------------------1----------1-21--------------------------------------------------------------1-------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 97.2 SQ:SECSTR ###TTEEccccEEEEEEccTTHHHHHHHHHHHHHHHTTcEEEEEEcccccHHHHHHHHTcccTTccHHHHHHHHHHHHHHHHTcEEEEcccccGGGcHHHHHHHHHHHHHHHHcccEEEEEccTTccHHHHHHHHHHHHHHHHHTTccEEEEccTTHHHHcccccccccTTEEEcccEEEEccHHHHHHHHHHHTTcHHHHHHHTcTTccHHHHHHHHHHHHHHHHHcTTcccEEEEEEEEEccc#### DISOP:02AL 1-10| PSIPRED cccccccccccEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccccccEEEccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccEEEEEcc //