[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69330.1
DDBJ      :             putative GntR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  390/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.78.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->210 3fmsA PDBj 4e-10 28.8 %
:RPS:PDB   1->216 3c7jA PDBj 9e-24 19.6 %
:RPS:SCOP  20->72 1e2xA1  a.4.5.6 * 9e-11 30.2 %
:RPS:SCOP  50->216 1e2xA2  a.78.1.1 * 1e-16 16.4 %
:HMM:SCOP  10->82 1hw1A1 a.4.5.6 * 4.7e-15 46.6 %
:RPS:PFM   20->73 PF00392 * GntR 2e-08 59.3 %
:RPS:PFM   88->207 PF07729 * FCD 3e-10 37.5 %
:HMM:PFM   86->208 PF07729 * FCD 8.7e-29 39.8 123/125  
:HMM:PFM   15->75 PF00392 * GntR 7.6e-20 49.2 61/64  
:BLT:SWISS 1->215 YDFH_SHIFL 5e-17 26.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69330.1 GT:GENE BAC69330.1 GT:PRODUCT putative GntR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1986092..1986742) GB:FROM 1986092 GB:TO 1986742 GB:DIRECTION - GB:PRODUCT putative GntR-family transcriptional regulator GB:NOTE PF07729: FCD domain GB:PROTEIN_ID BAC69330.1 LENGTH 216 SQ:AASEQ MPKEARPSTGEQAKQHALTQLRQAILHGEMAPAQRLVENELAEQFGVTRASIRAALIDLAAEGLVERIRNRGSRVRVVTVEEAVAITECRMVLEGLCAAKAAVAASDEQLTELADLGAAMTKAVADGEPVTYSELNHELHDRIREFSGQQTAVELLERLNAQLVRHRFQLALRPGRPQHSLNEHLSMIEAIRDRDPQAAEVAVRAHLTSVIEALRD GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 1->215|YDFH_SHIFL|5e-17|26.5|215/228| SEG 74->87|rvrvvtveeavait| BL:PDB:NREP 1 BL:PDB:REP 21->210|3fmsA|4e-10|28.8|177/206| RP:PDB:NREP 1 RP:PDB:REP 1->216|3c7jA|9e-24|19.6|209/232| RP:PFM:NREP 2 RP:PFM:REP 20->73|PF00392|2e-08|59.3|54/64|GntR| RP:PFM:REP 88->207|PF07729|3e-10|37.5|120/125|FCD| HM:PFM:NREP 2 HM:PFM:REP 86->208|PF07729|8.7e-29|39.8|123/125|FCD| HM:PFM:REP 15->75|PF00392|7.6e-20|49.2|61/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 2 RP:SCP:REP 20->72|1e2xA1|9e-11|30.2|53/73|a.4.5.6| RP:SCP:REP 50->216|1e2xA2|1e-16|16.4|146/149|a.78.1.1| HM:SCP:REP 10->82|1hw1A1|4.7e-15|46.6|73/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1137 OP:NHOMOORG 402 OP:PATTERN ------2-11-11111-1--------------------------------------------1----- 1-2-21-1111--1111----1--16-----111113588-1-33-----1-663-11----2--26332----------1-8------------------------------------------------------2243----2-----------------------1---------------111-1-3-2-----11-1---1--5-22-1--1--1-2--------15----------------------1-11----------------------------11----------------------------------22111----------22------1111--2312331211---3--12------222------22B55--43-23-65656564667-3263374488--D66944694887A62-2559-113624--------4221-3-2-------------------------------14--2IH893342435222255BD43223142EABED2244152223C5E-98122----1-----------212--2---1---2111-222121212-------1---------------------1-----11-113212132222222322224232232----1-1------1121-1-1111111111-111111111111111111222211---2122222222222222-1111111---11111111111--------------2264---1-----------34344151--2166463534357671446-------------111111121111122122-----------------------------------------------------------11-1--- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 216 STR:RPRED 100.0 SQ:SECSTR HHHccccccGGGHHHHHHHHHHHHHHTccccTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHcccHHcHHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHTTHHcccccccHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-16| PSIPRED ccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHcccEEEEcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcc //