[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69336.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.198.3
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   44->160 2a1vA PDBj 1e-15 24.8 %
:RPS:SCOP  45->146 2fkiA1  d.198.3.1 * 8e-20 17.8 %
:HMM:SCOP  41->163 2a1vA1 d.198.3.1 * 9.2e-26 33.3 %
:RPS:PFM   55->142 PF04237 * DUF419 7e-05 33.3 %
:HMM:PFM   54->143 PF04237 * DUF419 3.9e-23 39.3 89/92  
:BLT:SWISS 36->97 Y381_BORBU 6e-04 37.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69336.1 GT:GENE BAC69336.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1994047..1994535) GB:FROM 1994047 GB:TO 1994535 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04944: Uncharacterised BCR (COG3801) GB:PROTEIN_ID BAC69336.1 LENGTH 162 SQ:AASEQ MCRRPCRGRRHGTAPLSAVGCRCRLWAVRSRRALSVALVTVRLMLDAEDVRRIALSLPDTTEKVAWNMPTFRVAGKMFATVPEDETSIAVRCPKEERDELALAEPRKFWIADHEAGFAWVRVRLVALEDEAELRDILADSWRQAAPPRLIDAHPELGLPAAD GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 36->97|Y381_BORBU|6e-04|37.5|56/100| RP:PDB:NREP 1 RP:PDB:REP 44->160|2a1vA|1e-15|24.8|117/138| RP:PFM:NREP 1 RP:PFM:REP 55->142|PF04237|7e-05|33.3|87/94|DUF419| HM:PFM:NREP 1 HM:PFM:REP 54->143|PF04237|3.9e-23|39.3|89/92|DUF419| RP:SCP:NREP 1 RP:SCP:REP 45->146|2fkiA1|8e-20|17.8|101/118|d.198.3.1| HM:SCP:REP 41->163|2a1vA1|9.2e-26|33.3|123/0|d.198.3.1|1/1|YjbR-like| OP:NHOMO 19 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11-2----1----------------1-----111-------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------11-11----1--------1----------------------------------------------------------------------------1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 72.2 SQ:SECSTR ###########################################cccHHHHHHHHTTcTTEEEEccccEEEEEEEEEEEEEEETTccEEEEEccHHHHHHHHHHcTTTEEEcTTccTTTEEEEEccccccHHHHHHHHHHHHHHHHHHHccHHHHHHTccc## DISOP:02AL 1-8, 161-162| PSIPRED cccccccccccccccHHHHccccEEEEHHccHHEEEEEEEEcccccHHHHHHHHHHcccccccccccccccEEccEEEEEEEccccEEEEEccHHHHHHHHHccccEEEEccccccccEEEEEEEccccHHHHHHHHHHHHHHHccHHHHHHcHHccccccc //