[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69340.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  152/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.110.2
:193 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   40->179 3dbaA PDBj 3e-12 12.3 %
:RPS:SCOP  47->181 1f5mA  d.110.2.1 * 1e-12 13.2 %
:HMM:SCOP  37->189 1mc0A2 d.110.2.1 * 5.7e-19 28.4 %
:RPS:PFM   92->180 PF01590 * GAF 1e-06 35.2 %
:HMM:PFM   38->181 PF01590 * GAF 1.3e-19 29.0 131/154  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69340.1 GT:GENE BAC69340.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1998258..1998839) GB:FROM 1998258 GB:TO 1998839 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01590: GAF domain GB:PROTEIN_ID BAC69340.1 LENGTH 193 SQ:AASEQ MSYDPPRPIGRLLLTPEDKDAPERVRRLRRLGLGERPEPVFDAFADRLAEVAAVPYAMVNFIDENRQFFAGLHAPDGTGSGGRPAADGAEPPDVRRYMARDYGFCPHVVVRRKALVLEDVCDYPRFAGNPVVDEIGIRSYLGAPLIDRTGIALGTICVVDIEPRPWGRAGLETIKALAAELVEQIGRRESGGI GT:EXON 1|1-193:0| SEG 22->39|pervrrlrrlglgerpep| RP:PDB:NREP 1 RP:PDB:REP 40->179|3dbaA|3e-12|12.3|138/171| RP:PFM:NREP 1 RP:PFM:REP 92->180|PF01590|1e-06|35.2|88/143|GAF| HM:PFM:NREP 1 HM:PFM:REP 38->181|PF01590|1.3e-19|29.0|131/154|GAF| RP:SCP:NREP 1 RP:SCP:REP 47->181|1f5mA|1e-12|13.2|129/176|d.110.2.1| HM:SCP:REP 37->189|1mc0A2|5.7e-19|28.4|141/0|d.110.2.1|1/1|GAF domain-like| OP:NHOMO 261 OP:NHOMOORG 161 OP:PATTERN ------------------------1------------------------------------------- 221-2--1-------------2----------2111--------4---------1-------1-1-1223------------------------------------1-2---------------------------111-----1--1-1---1111211--1-211336-1-------1---11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11----------12--11111------------65353255-1-----1---11---1-11----2122-------------------------------------------------2-11---------1--2------11------111------11--22112------1--1211----------------1------------1-1----------1------------------------------11-111----11211111-111--1----------2--------2-1------------------------------------11--------------------------------------------------1-1----2----------------------1----12-12-2111---11222----------------------11--56465222--------11---------------------------------------------------1- -----------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1------------------112224- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 77.7 SQ:SECSTR #######################################HHHHHHHHHHHHHTEEEEEEEEEEEETTEEEEEEEEEEEEcTTccHHHHcccGGGccEEcTTccHHHHHHHHTccEEEccGGGcTTcccHHHHHccccccEEEEEEEETETEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-20, 190-193| PSIPRED ccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccHHHcccccccccccEEEEEEcEEcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc //