[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69345.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  276/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:406 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   100->329 3bk2A PDBj 7e-15 10.7 %
:RPS:SCOP  99->374 2i7tA1  d.157.1.10 * 7e-12 9.8 %
:HMM:SCOP  86->333 1vmeA2 d.157.1.3 * 1e-32 25.3 %
:HMM:PFM   103->305 PF00753 * Lactamase_B 2.9e-05 18.1 177/194  
:BLT:SWISS 16->365 Y930_MYCBO 2e-86 54.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69345.1 GT:GENE BAC69345.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2002445..2003665) GB:FROM 2002445 GB:TO 2003665 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00753: Metallo-beta-lactamase superfamily GB:PROTEIN_ID BAC69345.1 LENGTH 406 SQ:AASEQ MTGFRLPSSGLRAVRPAAFGADPSGERLERIRRSPNFVDGSFVNPEGTRTRPAGGSTLELAKVFLRKEERTRRSPAGTVPVHPTTFADLARPPASGLRLTWMGHSSVLAEIDGHRVLFDPVWGERCSPFDFVGPKRLHPVPLPLAALGPVDVVVISHDHYDHLDLPTIKALAGTDTVFAVPLGVGAHLEHWGVSPDRLRELDWNESTKVGGISLTATPARHFCGRGLRNVQHTLWASWAVAGDTHRIYHSGDTGYFGGFKDIGAEHGPFDATMIQIGAFSEFWPDIHMTPEEGMRAHLDLQGGRPGGVMLPIHWATFNLAPHPWVEPGEGTITAARAAGARIALPRPGEPFEPTAETVPSEPWWRGVAVTPQGGWPAVGPIPGDTPRDIPEGAVEGTGEPETVAAG GT:EXON 1|1-406:0| BL:SWS:NREP 1 BL:SWS:REP 16->365|Y930_MYCBO|2e-86|54.3|339/372| SEG 137->154|lhpvplplaalgpvdvvv| SEG 330->343|gtitaaraagaria| RP:PDB:NREP 1 RP:PDB:REP 100->329|3bk2A|7e-15|10.7|224/535| HM:PFM:NREP 1 HM:PFM:REP 103->305|PF00753|2.9e-05|18.1|177/194|Lactamase_B| RP:SCP:NREP 1 RP:SCP:REP 99->374|2i7tA1|7e-12|9.8|265/404|d.157.1.10| HM:SCP:REP 86->333|1vmeA2|1e-32|25.3|221/0|d.157.1.3|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 538 OP:NHOMOORG 423 OP:PATTERN --------------------------------------------------21---------------- 212-----------11111-11--1111111111111112--------------------12--111231------------------121--1-----1-2-1-321-1--------------1-------------------1----------------------------------------------111222222211112221-211--322111--12------12--------------------------------------------------------------------------------------------1-1----------------------------1----------------2-----------11111---11111------------11111111-11-11111111111111---------------------1-11--11-------------111--2----------1---------11111111----1111------112--------2--1--1---1--1-----1--------------22-11-1---1----11---1-1---1-5211-1---1111---1-----------1----41--1111-1-1---1-111-1--1--1--1----------1112-11-------------------------------1111-------------------1---------111111111111--------------13-1---112-------1-22222-1--11111121111--1---1111-111111---11111111211111111111---2111--1-221111----------------------------------------------12- 11--22--21--112222111111211---------1111111---1111111111112122111111111111111111111111---3-121114333114222-1-2-121113-11-11132111761-1111-111111211111111111111----2--------431111-----11--1-2-1121---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 323 STR:RPRED 79.6 SQ:SECSTR ######ccHHHHHHHHHHHHHccTTccHHHHHTTEcccccccccTTcccccTTccEEcGGccGGGccHHHHHHHHccTTTTHHHHHHHTcccccccEEEccccccEEEEEETTEEEEEccccccccTTTTcTccEEEEccHHHHHTGGGEEEEEcccccHHHHTTHHHHHHHHccccccEEEEEHHHHHTcccTTcEEEEEcTTcEEEETTTEEEEEEEcccccccEEEEEEETTEEEEEccccccccccTTccccccHHHHHHHHHcccEEEEcTTTTcccccccHHHHHHHHHHHHHccccEcccEEEEccTTcHHHHHHHHHHHHH############################################################################# DISOP:02AL 1-34, 377-396, 399-406| PSIPRED cccccccHHHHHHcccccccccccHHHHHHHHHcccccccEEEccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHcccccccEEEEEEEEEEEEEEEccEEEEEcccccccccccccccccccccccccHHHcccccEEEEcccccccccHHHHHHHHccccEEEEEccHHHHHHHccccHHcEEEEccccEEEEccEEEEEEEEcccccccccccccEEEEEEEEEccccEEEEEccccccHHHHHHHHHcccccEEEEcccccccccccEEccHHHHHHHHHHHHccccccEEEEEEccccccccHHHcccHHHHHHHHHHcccEEEEEccccEEEcccccccccHHHccHHHccccccccccccccccccccHHHcccccccccEEccc //