[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69351.1
DDBJ      :             putative secreted peptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  705/915 : Eukaryota  7/199 : Viruses  13/175   --->[See Alignment]
b.71.1b.84.3d.7.1
:301 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   191->295 2hsiB PDBj 4e-19 44.1 %
:RPS:PDB   69->119 1e01A PDBj 5e-07 45.5 %
:RPS:PDB   171->294 2b44A PDBj 1e-21 34.7 %
:RPS:SCOP  69->119 1e0gA  d.7.1.1 * 2e-07 45.5 %
:RPS:SCOP  184->289 2fhbA4  b.71.1.1 * 3e-23 16.0 %
:HMM:SCOP  68->122 1e0gA_ d.7.1.1 * 0.00032 37.5 %
:HMM:SCOP  191->293 1qwyA_ b.84.3.2 * 2.5e-36 50.5 %
:RPS:PFM   191->278 PF01551 * Peptidase_M23 1e-19 54.5 %
:HMM:PFM   192->289 PF01551 * Peptidase_M23 3.1e-33 50.5 95/96  
:HMM:PFM   72->119 PF01476 * LysM 6.9e-07 32.6 43/44  
:BLT:SWISS 177->300 YOMI_BACSU 1e-18 38.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69351.1 GT:GENE BAC69351.1 GT:PRODUCT putative secreted peptidase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2008712..2009617) GB:FROM 2008712 GB:TO 2009617 GB:DIRECTION - GB:PRODUCT putative secreted peptidase GB:NOTE PF01551: Peptidase family M23 GB:PROTEIN_ID BAC69351.1 LENGTH 301 SQ:AASEQ MPAKGKHRRPRSPRFTRSIAVAGTGGAALALPLMGATGAHAATPTAAVSGKVSAAPVAAKQGAAEKSGTKTYAVRAGDSLSKIADEQSVTGGWKKLYSDNRSAIGGDPTLIHPGLKLTIGAKSASSAATQSSTATKPATGVKSATAKTPASKTTTATRAADTTTGAGYTLPVDGATIGTAYKTAGSMWSSGYHTGVDFVVPTGTTIKAVAAGTVVSAGWGGAYGNEVVVRHADGQYSQYAHMSQLSVSTGQSVAEGRQLGLSGATGNVTGPHLHFEIRTTPSYGSDVDPVAYLRAHGVVVG GT:EXON 1|1-301:0| BL:SWS:NREP 1 BL:SWS:REP 177->300|YOMI_BACSU|1e-18|38.8|121/2285| SEG 20->47|avagtggaalalplmgatgahaatptaa| SEG 121->139|aksassaatqsstatkpat| SEG 144->169|ataktpasktttatraadtttgagyt| BL:PDB:NREP 1 BL:PDB:REP 191->295|2hsiB|4e-19|44.1|102/228| RP:PDB:NREP 2 RP:PDB:REP 69->119|1e01A|5e-07|45.5|44/48| RP:PDB:REP 171->294|2b44A|1e-21|34.7|124/129| RP:PFM:NREP 1 RP:PFM:REP 191->278|PF01551|1e-19|54.5|88/96|Peptidase_M23| HM:PFM:NREP 2 HM:PFM:REP 192->289|PF01551|3.1e-33|50.5|95/96|Peptidase_M23| HM:PFM:REP 72->119|PF01476|6.9e-07|32.6|43/44|LysM| RP:SCP:NREP 2 RP:SCP:REP 69->119|1e0gA|2e-07|45.5|44/48|d.7.1.1| RP:SCP:REP 184->289|2fhbA4|3e-23|16.0|106/118|b.71.1.1| HM:SCP:REP 68->122|1e0gA_|0.00032|37.5|48/48|d.7.1.1|1/1|LysM domain| HM:SCP:REP 191->293|1qwyA_|2.5e-36|50.5|103/270|b.84.3.2|1/1|Duplicated hybrid motif| OP:NHOMO 2171 OP:NHOMOORG 725 OP:PATTERN -------------------------------------------------------------------- 111-131322211111111-151111111111212267991--1-2111351544112--427-232788-------------2-512443435111--4222331112----------------22242434142322-----42G534453433312233223458864-3-----3----53232222-1-444443433435443321111444--133742-----621223333143332232--112------------------1---12-111-----------------------------------------433--11111111113-11-343214-1621646645445435565531-33-533222222223333333333333333333334-334435343451433333333333325453111111111-------------33411----------22222222212211--11754415555622222232333111133333322123221211122333212223332124323222222223334433432434553445535324354466567421222334444333322223223322211552333324324454464564546558566--1323311----44332434434444544-454444444544444444343433333333333333333333334434444314333333333331113111112222-3524121232233212222222222111-5455454344544446444---------244565556575644666555544445352-337777664442432355--------------------------2111111111--- ------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------11------6--1--1--1---- -1--------------------------------------------------------------------------------1---------------------11--11--11--------1---1-------111-------------------------------------- STR:NPRED 190 STR:RPRED 63.1 SQ:SECSTR #####################################################cccccc#ccccccEEcEEEEEcTTccHHHHHHHHTcc##HHHHHHHcT###ccccccccTTEEEEE###################################################ccTHHHHTcEEEccEEcTTccEEccEEEEccTTcEEEccccEEEEEEEEcccccEEEEEEETTccEEEEEEEccccccTTcEEcTTcEEEEccccccccccEEEEEEEccccGGGEEccHHHHccccHHH# DISOP:02AL 1-4, 7-23, 39-72, 129-131| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEccccccccccccccccEEEcccccccEEEEccccEEEEEEEccccccEEEEEEcccEEEEEEEccccccccccEEEcccEEEEEEccccccccEEEEEEEEccccccEEccHHHHHHcccccc //