[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69354.2
DDBJ      :             putative small hydrophobic secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:49 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->44 PF10808 * DUF2542 0.00052 39.3 28/79  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69354.2 GT:GENE BAC69354.2 GT:PRODUCT putative small hydrophobic secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2013146..2013295) GB:FROM 2013146 GB:TO 2013295 GB:DIRECTION - GB:PRODUCT putative small hydrophobic secreted protein GB:PROTEIN_ID BAC69354.2 LENGTH 49 SQ:AASEQ MTEQPESSQNRRSMEEKFPRALWVRLIIYIAVGHLFAGFIYLLFELGAK GT:EXON 1|1-49:0| TM:NTM 1 TM:REGION 22->44| HM:PFM:NREP 1 HM:PFM:REP 17->44|PF10808|0.00052|39.3|28/79|DUF2542| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17,49-50| PSIPRED cccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //