[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69355.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  153/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1b.82.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->180 1zz6A PDBj 1e-05 26.9 %
:RPS:PDB   29->74 3bd1B PDBj 6e-08 15.6 %
:RPS:PDB   45->184 1e5rA PDBj 5e-15 11.5 %
:RPS:SCOP  29->76 2auwA1  a.35.1.10 * 7e-10 22.9 %
:RPS:SCOP  47->181 2pytA1  b.82.1.24 * 2e-12 13.1 %
:HMM:SCOP  7->85 1y9qA1 a.35.1.8 * 4.7e-14 36.7 %
:HMM:SCOP  77->184 2bnmA2 b.82.1.10 * 5e-28 37.0 %
:RPS:PFM   29->73 PF01381 * HTH_3 6e-06 44.4 %
:RPS:PFM   129->182 PF07883 * Cupin_2 6e-06 46.3 %
:HMM:PFM   114->181 PF07883 * Cupin_2 3.3e-17 37.3 67/71  
:HMM:PFM   19->73 PF01381 * HTH_3 8e-16 40.0 55/55  
:BLT:SWISS 33->184 PUUR_SHIFL 1e-06 24.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69355.1 GT:GENE BAC69355.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2013292..2013918) GB:FROM 2013292 GB:TO 2013918 GB:DIRECTION - GB:PRODUCT putative regulatory protein GB:NOTE PF01381: Helix-turn-helix GB:PROTEIN_ID BAC69355.1 LENGTH 208 SQ:AASEQ MSSSESGPVEDLPAVAPQLRALRRRASLTLEVAARAAGLSPAHLSRLETGQRQPSLPMLLALARIYGTTVSELLGETVGDRDAVVRAADMEPAGAGGWTYWQAGAGGRAMQALRVHVPYGTQGDVVRVHPGEEWLYVLKGRLRLRLGDTTHLLGPGDSAHFDSLTPHRLAAADHDGAELLFLHTLLQSPAATLCLGPATGHPTMGDTP GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 33->184|PUUR_SHIFL|1e-06|24.5|151/185| SEG 12->28|lpavapqlralrrrasl| BL:PDB:NREP 1 BL:PDB:REP 62->180|1zz6A|1e-05|26.9|119/181| RP:PDB:NREP 2 RP:PDB:REP 29->74|3bd1B|6e-08|15.6|45/63| RP:PDB:REP 45->184|1e5rA|5e-15|11.5|139/260| RP:PFM:NREP 2 RP:PFM:REP 29->73|PF01381|6e-06|44.4|45/55|HTH_3| RP:PFM:REP 129->182|PF07883|6e-06|46.3|54/70|Cupin_2| HM:PFM:NREP 2 HM:PFM:REP 114->181|PF07883|3.3e-17|37.3|67/71|Cupin_2| HM:PFM:REP 19->73|PF01381|8e-16|40.0|55/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 2 RP:SCP:REP 29->76|2auwA1|7e-10|22.9|48/67|a.35.1.10| RP:SCP:REP 47->181|2pytA1|2e-12|13.1|122/128|b.82.1.24| HM:SCP:REP 7->85|1y9qA1|4.7e-14|36.7|79/0|a.35.1.8|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 77->184|2bnmA2|5e-28|37.0|108/0|b.82.1.10|1/1|RmlC-like cupins| OP:NHOMO 274 OP:NHOMOORG 158 OP:PATTERN ----------------------------------1---1-11-------1------------------ 111-2----------22----1--11-----111111332-1-112---1--111-11--33--313244----------1-3-----111--1-------------------------------------------11----------------------------------------------------------------1-1----------1--1------------1----------------------------------------------------------------------------------------------------------------------1------------1----------------------4----2-----11111111111---3--1---1--3111322222331-----2------11-----------1---1--------------------------------1---2111455554333322232444413433--31----11---------211------------------1--24--221112112-1-1-11-2--------1---------------------------11----------------------------------------------------------------------------------------------------------------1--------------------------------------------------------11111-1-1111----1------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 86.5 SQ:SECSTR ############################cHHHHHTHTTTcHHHHccEEEEEccccHHHHHHHHHHHHHcccccccccTcEEEEEEEEccccTTTTcccHHHHHHcccccEEEEEEEEEEcEEEEEEcccccccEEEEccccTTEEEEETEEcccTTEEEEccTTccEEEEEcccccccEEEEEEHHHHHHHHHHHHTTTccEEEEEcc DISOP:02AL 1-11, 124-125, 200-208| PSIPRED ccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHccccEEEEEccccccccccccEEcccccccccEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEEcccccEEEEEcccccEEEEEEEccccccHHHHccccccccccccccc //