[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69366.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  871/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:259 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   38->231 1oxvA PDBj 1e-17 32.4 %
:RPS:PDB   52->256 3dmdC PDBj 4e-29 12.1 %
:RPS:SCOP  48->252 1b0uA  c.37.1.12 * 6e-30 29.6 %
:HMM:SCOP  41->254 1g6hA_ c.37.1.12 * 3.5e-42 32.7 %
:RPS:PFM   80->188 PF00005 * ABC_tran 3e-04 31.5 %
:HMM:PFM   80->190 PF00005 * ABC_tran 1.2e-09 26.9 104/118  
:HMM:PFM   57->94 PF01078 * Mg_chelatase 0.00017 31.6 38/207  
:BLT:SWISS 55->256 TAGH_BACSU 2e-49 47.7 %
:PROS 163->177|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69366.1 GT:GENE BAC69366.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2027207..2027986) GB:FROM 2027207 GB:TO 2027986 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC69366.1 LENGTH 259 SQ:AASEQ MAEQRNDSHIPTVIADELHIVYRVNGAKTGKGSATAALSRIVKRGEERGVRKVHAVKGVSFTAYRGEAIGLIGSNGSGKSTLLRAIAGLLPAEKGKVYTDGQPSLLGVNAALMNDLTGERNVILGGLAMGMSREQIRERYQEIVDFSGINEKGDFITLPMRTYSSGMAARLRFSIAAAKDHDVLMIDEALATGDRKFQKRSEARIRELRKEAGTVFLVSHNNKSIRDTCDRVLWLERGELRMDGPTEEVLKEYEKFTGK GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 55->256|TAGH_BACSU|2e-49|47.7|199/527| PROS 163->177|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 26->37|gaktgkgsataa| BL:PDB:NREP 1 BL:PDB:REP 38->231|1oxvA|1e-17|32.4|185/353| RP:PDB:NREP 1 RP:PDB:REP 52->256|3dmdC|4e-29|12.1|198/318| RP:PFM:NREP 1 RP:PFM:REP 80->188|PF00005|3e-04|31.5|108/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 80->190|PF00005|1.2e-09|26.9|104/118|ABC_tran| HM:PFM:REP 57->94|PF01078|0.00017|31.6|38/207|Mg_chelatase| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 48->252|1b0uA|6e-30|29.6|203/258|c.37.1.12| HM:SCP:REP 41->254|1g6hA_|3.5e-42|32.7|211/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 16531 OP:NHOMOORG 1090 OP:PATTERN JJA5DA77BBCB9AC9O59A9CAIT89KGDBA54643235635EL8HN7BVNJ4DJFHGCB575G-23 BCN6jIFFHHKBEBG6555-5A338T555556HKILJYPQCK8OGPNHFIFAOKNCAD44PQJ8SMRYdeN9AAAJEFG9MEN527444446-7685--69B589C797D1333123122333369737456C5B9LQQUV666SDCEITDCJGKBC858575GDFJMINC3B1653484734HCEDAHE1CRReegefdflTegfacfkVUUNOfciKQWWaNRVVWRSWtnICCCECBBBBCCCAACFCCEMFB9SS86BEFNN99SRBD99CGFGHLLMKLINQLMPMMNJKMOKMLFFFFFFGGFEFFGSLKGFHLKMIIUOPXaYaebZZHWFINUUFJKKbLLJFXKMG9dcNGKGMFBHLFQGABC9AKEBB857649EDvq*66JSNMRNYZUYYWbRUZ*-GGODBVJPizA4*xx**vx*****xgBB6OYsXRWYaTWCBCCCCCCHBD87JCO11------221-11111111111111-1-664945TqgQfUXZaeXTOMNKZZcmRQOPHVbVwRJTO36KLGSILJJTLeWiqAFE7A89GA9987877978ACCEIW9GAFHE8KCBG6GHGBFEN9BGJAHKIGL15585344534141------5654664ILM6CA7574I9ABB969A9A99BBB5AAF--57777------TLcU9MGJMLIKJIKIK-LJIJOILLKJMKLKJIKKJSZUWXDAKIGHIEHGHIHHGIGIHTEGGJIGJ7-LNPPQPQOORQR--59898888679A2OERCBDFBG4686799AB99BA955357DEIGDGIRNTHORNICSRV8664667566ACELIJJJJJMLLM77676776676777--7DAA56661----1-1K5B32312-113113111-234212---DPJ97NROQO4HB ----861-321528312211--111112211-1-1--222112---22332141111-3222-111--111-221----------2-1----2---2-1-11-----3-5A786H8H2251595LL2L1IwC2D4J6735B33QA48321E24s4865I1-E55511C45M5B866541822222C549-FC1363661 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 31-32, 255-259| PSIPRED cccccccccccEEEEEccEEEEEEcccccccHHHHHHHccEEEEEEEEEcccEEEEccccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHHHHHHHHcc //