[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69367.1
DDBJ      :             putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:309 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   58->267 PF01061 * ABC2_membrane 8.2e-19 23.5 200/208  
:BLT:SWISS 56->257 RFBA1_KLEPN 1e-17 26.8 %
:PROS 283->297|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69367.1 GT:GENE BAC69367.1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2027979..2028908) GB:FROM 2027979 GB:TO 2028908 GB:DIRECTION - GB:PRODUCT putative ABC transporter permease protein GB:NOTE PF01061: ABC-2 type transporter GB:PROTEIN_ID BAC69367.1 LENGTH 309 SQ:AASEQ MSETTHDGGVAVSARPSPDEGLSGAELAAKYGLAVSGARPGLVEYVRQLLGRRHFILAFSQAKLTAQYSQAKLGQLWQVATPLLNAAVYYLIFGLILHASKGMPSDVYIPFLVTGVFVFTFTQSSVMAGVRAISGNLGLVRALHFPRAALPISFSLQQLQQLLFSMIVLFLVAIGFGSYPSLSWVLIVPVLALQFLFNTGLALIMARMGAKTPDLAQLMPFVMRTWMYASGVMFSIPVMLADKPAWVADVLQWNPAAIYMDLMRFALIDGYGSENLPPHVWAVAAGWAVLVALGGFVYFWKAEERYGRG GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 56->257|RFBA1_KLEPN|1e-17|26.8|194/259| PROS 283->297|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 6 TM:REGION 74->96| TM:REGION 114->136| TM:REGION 158->180| TM:REGION 185->207| TM:REGION 227->249| TM:REGION 278->300| SEG 113->122|vtgvfvftft| SEG 156->163|lqqlqqll| SEG 280->295|vwavaagwavlvalgg| HM:PFM:NREP 1 HM:PFM:REP 58->267|PF01061|8.2e-19|23.5|200/208|ABC2_membrane| OP:NHOMO 135 OP:NHOMOORG 124 OP:PATTERN -------------------------------------------11--1-------------------- ----1--------------------------------------1-1211--1---11---11-----222-----1------1----------------1------11----------------1---------1-21111---2----1-------------1---------------------------1-1----------------1111--------111111111--2--------------1---22-1--------11------11--1-----11111--------------------------111111111------------------------------1-1---1------1-------------------------------1-------------------1---------1--11------------------------------1--------------------------------------11--1----1---------------11---1-------------1--------1-------------------1---2-----1-1-----1------1-11----------------------------------------------------------------------------1---1-1-1-1-----2-111--111--11-111-----------------------------1----------------------1111-------------------------------1------1------------------------------------------------------------------1--------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-21, 308-309| PSIPRED cccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //