[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69379.1
DDBJ      :             hypothetical alanine-rich protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:255 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 152->255 DFA1_THEEB 7e-04 34.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69379.1 GT:GENE BAC69379.1 GT:PRODUCT hypothetical alanine-rich protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2039912..2040679 GB:FROM 2039912 GB:TO 2040679 GB:DIRECTION + GB:PRODUCT hypothetical alanine-rich protein GB:PROTEIN_ID BAC69379.1 LENGTH 255 SQ:AASEQ MAAVGVGDVQAAYFAARAAAMGPVGAGVVTATFHNFRHELVAAHVPGVWGTASPEVVLAARARAVDATLRRLLGAELLAAEEVAEAAELALRATEACSRNARPLYAAHADLPVPDAPHLALWHAATLLREHRGDGHLTVLLGAELDPVEALVSHTATGKGMAPKWALATRGWSQEHWEAAVLRLRERGLLDAEGELTEAGTALRKEIEAQTDRIDRAPYEHLGAAGVARLTELAAGLLSRAMAAGAFPTGMIGKS GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 152->255|DFA1_THEEB|7e-04|34.4|93/100| SEG 11->31|aayfaaraaamgpvgagvvta| SEG 56->96|vvlaararavdatlrrllgaellaaeevaeaaelalratea| OP:NHOMO 34 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----1---------111----1--11-----111112211-3---------------1--12--111222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccccHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHccc //