[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69386.1
DDBJ      :             putative metallopeptidase, secreted
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  283/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
b.98.1d.92.1
:497 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   89->455 1z1wA PDBj 2e-24 28.4 %
:RPS:PDB   46->457 2dqmA PDBj 5e-58 17.0 %
:RPS:SCOP  35->224 1gw6A2  b.98.1.1 * 5e-27 17.9 %
:RPS:SCOP  254->457 1gw6A3  d.92.1.13 * 3e-30 21.3 %
:HMM:SCOP  31->225 1hs6A2 b.98.1.1 * 5e-36 31.2 %
:HMM:SCOP  233->465 1hs6A3 d.92.1.13 * 1.7e-51 32.6 %
:RPS:PFM   94->398 PF01433 * Peptidase_M1 3e-28 35.0 %
:HMM:PFM   48->398 PF01433 * Peptidase_M1 3.3e-47 28.4 348/391  
:BLT:SWISS 146->457 AMPE_BOVIN 1e-29 31.3 %
:PROS 314->323|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69386.1 GT:GENE BAC69386.1 GT:PRODUCT putative metallopeptidase, secreted GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2050745..2052238 GB:FROM 2050745 GB:TO 2052238 GB:DIRECTION + GB:PRODUCT putative metallopeptidase, secreted GB:NOTE PF01433: Peptidase family M1 GB:PROTEIN_ID BAC69386.1 LENGTH 497 SQ:AASEQ MHRRLIAPGALAASLLLAIPASAASYSPGAPGIGDPYYPAYGNGGYDVSHYDLRLKYQPRTDELEGTATLLATTKQDLSRFDLDFLLDVSEVRVNGAKASFTTSGQHELEITPATPLPKGTPVTVVVRYSGVPSTKSAYGFSTWHRTPDGAVAADEPEAAWWWYPSNDHPSDKATYDVSVAVPDGTQAISNGLLQSTSSKLGWTRYNWRSTKPQATYLTTLAVGRFDITTGKTSDGIPVINAYSKDLGDNDGAARASVERTGELVDWLSGYFGPYPFNSVGGYVPNTTTGYALETQTRVYYSPKQFANGSNTSVVVHELAHQWYGDDVSLAGWKDIWINEGFARYAQWLWSEHEGEGTTQELADYVYASHPADDAFWTVKPGDPGPDDQFDTAVYDRGALAVQALRNEIGDDAFFAVLKGWPKDHAYGNAAVGDFQKYAEKVSGKSLAALFDTWLFQPSKPAASAAKGASLASRTAAATVQPRSWKKIAATNSAHQG GT:EXON 1|1-497:0| BL:SWS:NREP 1 BL:SWS:REP 146->457|AMPE_BOVIN|1e-29|31.3|307/956| PROS 314->323|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 1 TM:REGION 5->27| SEG 6->34|iapgalaaslllaipasaasyspgapgig| SEG 67->74|tatllatt| SEG 77->88|dlsrfdldflld| SEG 458->473|pskpaasaakgaslas| BL:PDB:NREP 1 BL:PDB:REP 89->455|1z1wA|2e-24|28.4|345/780| RP:PDB:NREP 1 RP:PDB:REP 46->457|2dqmA|5e-58|17.0|401/867| RP:PFM:NREP 1 RP:PFM:REP 94->398|PF01433|3e-28|35.0|294/379|Peptidase_M1| HM:PFM:NREP 1 HM:PFM:REP 48->398|PF01433|3.3e-47|28.4|348/391|Peptidase_M1| GO:PFM:NREP 2 GO:PFM GO:0008237|"GO:metallopeptidase activity"|PF01433|IPR014782| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01433|IPR014782| RP:SCP:NREP 2 RP:SCP:REP 35->224|1gw6A2|5e-27|17.9|190/208|b.98.1.1| RP:SCP:REP 254->457|1gw6A3|3e-30|21.3|202/252|d.92.1.13| HM:SCP:REP 31->225|1hs6A2|5e-36|31.2|192/208|b.98.1.1|1/1|Leukotriene A4 hydrolase N-terminal domain| HM:SCP:REP 233->465|1hs6A3|1.7e-51|32.6|230/252|d.92.1.13|1/1|Metalloproteases ("zincins"), catalytic domain| OP:NHOMO 1496 OP:NHOMOORG 492 OP:PATTERN ------21222222221211111--------------------------------------222--11 2221532222221131111-12112211111222223233-222-114222-343234113342332C6611111111-----------1-1-1--1--31532252423------------------1-1----11-------1-111-111--11-----111121111-------------11----------------------------------------------1---------------------111111111111111111111111111111111111111111111111111111111111--111---1-11--------------11-----------------------1111----1--311---------------------------------------------------------11--------------------111-----------------------------------11-1-----1111111----111-------11-------111---------1-----------------1111-----------------1-1-111--111144-1------------------------------1-11122-2333312233331323322---1-----------------------------------------------------------------------------------------------3-----------------------------111111-----------------------------------------------11343443331111----111111------------------------------------------------- ----552-121-55232223333323322222222222122332323323223223232333431322322232222-3221112111-111214-11213113333433FEEA9CD6735583AA7C5M*C1C8J7556A39AA55434A25H6A6987IMCE8I6P9FYAEAE11128---2113422132242432 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 423 STR:RPRED 85.1 SQ:SECSTR ##################################cTTcccccTTTEEEEEEEEEEEcccccEEEEEEEEEEEcccTTccEEEEccccEEEEEEETTEEcccEEcccEETTEEEEcccccEEEEEEEEEEcGGGcTTccEEEcGEEEETTEEEEEcTTTTGGGTccccccTTcccEEEEEEEEETTTccEEEEccEEEEEEETEEEEEEEccccccGGGccEEEEccEEEEcTTccEEEEEEEEcTTcGGGHHGcHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccEEccTTEEEEEGGGTcccTTTcHHHHHHHTTTcTTTEEEccGGGHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHTHHHTcTTcccccccGGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTEEEcHHHHHHHHHHHHTcccHTTTTHHHHc######################################## DISOP:02AL 26-31, 492-497| PSIPRED ccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEccEEEEEEEcccEEEEEEEccccccccEEEEEEEEEEEEccccccccccEEEccccEEEEcccccccEEEEEcccccccEEEEEEEEEccccEEEEccEEcccEEcccEEEEEEEEcccccHHHEEEEEEccEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccHHHHcccccHHHccccHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccccccHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHcccccEEEEEEEcccccccEEEEEEEEccccccccccccccc //