[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69394.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  102/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:391 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   13->82 2bgkA PDBj 2e-04 20.9 %
:RPS:SCOP  12->96 1xq6A  c.2.1.2 * 6e-06 23.1 %
:HMM:SCOP  8->204 1e5qA1 c.2.1.3 * 2.1e-15 20.8 %
:RPS:PFM   13->181 PF03435 * Saccharop_dh 7e-20 39.7 %
:HMM:PFM   12->161 PF03435 * Saccharop_dh 4.9e-22 22.7 141/386  
:BLT:SWISS 8->383 TAER_MYCUA 4e-38 37.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69394.1 GT:GENE BAC69394.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2061478..2062653 GB:FROM 2061478 GB:TO 2062653 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03435: Saccharopine dehydrogenase GB:PROTEIN_ID BAC69394.1 LENGTH 391 SQ:AASEQ MSRLKTDRAYDIVLFGATGFVGTLTAEYLAAHAPEGLRWAIAGRSARRLEQVRERLGGASEIGILQADVADPGSLRDIARNARVVATTVGPYLNYGEELVAACADAGTDYADLTGEPEFVDLTYVRHDARARETGARLVHACGFDSIPHDLGAYFTVRQLPEGVPLTVDGYVRSQAMFSGGTFASALNQFARGPQMLAAARDRRRHEPRVVGRRVQAPLGAPRFAKEVGAWALPLPTIDSQIVQRSARVLERYGPDFRYRHYAAVEQLPFAAGGVAAVSALFAAAQLPPARRWLSGRLKPGDGPSAEKRAKSWFSVRFVGEGGGQRVYTEVAGGDPGYDETAKMLAESALSLALDDLPHTSGQVTTAVAMGDALIDRLRAAGITFRVAAKR GT:EXON 1|1-391:0| BL:SWS:NREP 1 BL:SWS:REP 8->383|TAER_MYCUA|4e-38|37.9|375/418| SEG 198->215|aaardrrrheprvvgrrv| SEG 270->285|faaggvaavsalfaaa| SEG 345->357|laesalslalddl| RP:PDB:NREP 1 RP:PDB:REP 13->82|2bgkA|2e-04|20.9|67/267| RP:PFM:NREP 1 RP:PFM:REP 13->181|PF03435|7e-20|39.7|156/332|Saccharop_dh| HM:PFM:NREP 1 HM:PFM:REP 12->161|PF03435|4.9e-22|22.7|141/386|Saccharop_dh| RP:SCP:NREP 1 RP:SCP:REP 12->96|1xq6A|6e-06|23.1|78/253|c.2.1.2| HM:SCP:REP 8->204|1e5qA1|2.1e-15|20.8|183/183|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 351 OP:NHOMOORG 258 OP:PATTERN --------------------------1-111------------------------------------- ----1------1-111122-21112122222211112161----1---------1-1---111-111111-----------------------------------1--1---------------------------111-------1--1-------------11-1---------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------2--1-------11111----------------------------1-----------------1--------------------------------------------------------11-1------111111-----22--------1--------11--1---1------------------------------1---------------------11-11--------------------------------11--11----------------------------------1------------------------------------------------------------------------------------------------11-----------------11111--111--1111-1-------------------------------1---------------------------------------------------------------------------- ---1--2-21----111111-112111111111111-1111111111111312211111111----------------------------211121111111122212912121152111112132111161-11111112-11111-111112111121111112-42411321-212A221212--11112221125 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 35.3 SQ:SECSTR HHHHTTcE###EEEEcTTcHHHHHHHHHHHHTTcTTcEEEEEEccHHHHHHHHHHHccTTTEEEEEccTTcHHHHHHHHHHHcEEEEcccccccccccHHHHHcGGGGGGccEEEEEcccHHHHHHHHHHHHHHTccEEEE########################################################################################################################################################################################################################################################## DISOP:02AL 1-6, 298-312| PSIPRED cccccccccccEEEEccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHcccEEEEccccHHHccHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccccHHHHHHHHHHcccHHHHHccccccccccccccccccccccEEEEEccccEEEEEccccccHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccccHHHHccccEEEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHHHHHHHccccccccEEccHHHHHHHHHHHHHHcccEEEEEEcc //