[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69396.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->103 PF07498 * Rho_N 0.00011 32.0 25/43  
:HMM:PFM   13->58 PF01056 * Myc_N 0.00054 26.1 46/329  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69396.1 GT:GENE BAC69396.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2063421..2063747) GB:FROM 2063421 GB:TO 2063747 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC69396.1 LENGTH 108 SQ:AASEQ MPRGSSPKRERQYEHIKQSAQDRGESQGRAEEIAARTVNKERARSGESKTASKTSTNDMSSGKRGGQRSHTGSAGPTYDQLYEEAKRRNIHGRSDMNKSQLKQALGNK GT:EXON 1|1-108:0| HM:PFM:NREP 2 HM:PFM:REP 79->103|PF07498|0.00011|32.0|25/43|Rho_N| HM:PFM:REP 13->58|PF01056|0.00054|26.1|46/329|Myc_N| OP:NHOMO 21 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ----2-------1-----------------------1---------1---------------1---1111-------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------1---------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1------111------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-77, 88-96, 107-108| PSIPRED cccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHccc //