[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC69403.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:256 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->77 PF01756 * ACOX 0.00043 27.8 36/186  
:BLT:SWISS 86->166 MENC_CITK8 4e-04 37.2 %
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69403.1 GT:GENE BAC69403.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(2070860..2071630) GB:FROM 2070860 GB:TO 2071630 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF06188: HrpE protein GB:PROTEIN_ID BAC69403.1 LENGTH 256 SQ:AASEQ MRELALHVRVMSPPRPVLEARGAYERGIAVVAASVARGTQWIAERIADAEPFVRGHALRVADSLQVPDTVYESALGDACEAVCRDLLRGIVVGRRTALADRLADGLRRDWGDAEAARLLPGCAPETVARLLPGLFHAVTGWKTLANRHPRTVLDAAEQALATLPEALRAPWWSRYAPAVAATVTAEPLRARALLERLGPETMPPRLRKHLGDFAVAAPGRLLRLLLTPAWHAVRRHRGLGPGVLRTLARKQLTAYE GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 86->166|MENC_CITK8|4e-04|37.2|78/100| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| SEG 176->200|apavaatvtaeplrarallerlgpe| HM:PFM:NREP 1 HM:PFM:REP 42->77|PF01756|0.00043|27.8|36/186|ACOX| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----2--------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 254-256| PSIPRED ccccEEEEEEcccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccc //