[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAF64418.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->93 PF02588 * DUF161 1e-06 22.7 75/82  
:HMM:PFM   113->188 PF02588 * DUF161 1.5e-06 20.0 75/82  
:BLT:SWISS 14->203 Y522_HAEIN 4e-23 37.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAF64418.1 GT:GENE BAF64418.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1242699..1243340) GB:FROM 1242699 GB:TO 1243340 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF07754: Domain of unknown function (DUF1610) SAV979.1 GB:PROTEIN_ID BAF64418.1 LENGTH 213 SQ:AASEQ MNAFAQVRAAGKARRIPQLLLGLMGYGASVMLLVQSGLGAASWNVLTEGTAKSLDISFGWATNLISLLVLIAWIPLRELPGLGTLLNVAIVGFAADATATVLPNPQGPLAEIGYLALGLVALAFFDALYLGAQFGSGPRDGIMTGLVRLTHLPVALVRTGIEVAVACVGWLLGGTVGVGTVLIALCMGPLVGCFLPLVAVHLPAVSAPTRHTR GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 14->203|Y522_HAEIN|4e-23|37.4|190/218| TM:NTM 6 TM:REGION 19->41| TM:REGION 55->77| TM:REGION 80->102| TM:REGION 112->134| TM:REGION 144->166| TM:REGION 181->203| SEG 168->182|vgwllggtvgvgtvl| HM:PFM:NREP 2 HM:PFM:REP 19->93|PF02588|1e-06|22.7|75/82|DUF161| HM:PFM:REP 113->188|PF02588|1.5e-06|20.0|75/82|DUF161| OP:NHOMO 77 OP:NHOMOORG 72 OP:PATTERN -------------------------------------------------------------------- ----1---------1------1---2------1111-111----1211-11-111-----111-1112121-------------------------------------------------------------------------11-------------------------------------1-----------------------------1----1-12---------1-------------------------------------------1----------------------------------------------1-11---------1---111---------1----11-----1---------------1------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-------------------------------111-------------------------------------------------------------1111-1-11-11111-----------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,207-214| PSIPRED ccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //