[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : acsA3
DDBJ      :acsA3        putative acetoacetyl-CoA synthetase
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  619/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:672 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->649 2p2mA PDBj 3e-51 28.8 %
:RPS:PDB   84->636 2d1sA PDBj 1e-45 14.2 %
:RPS:SCOP  47->648 1pg3A  e.23.1.1 * 1e-53 22.1 %
:HMM:SCOP  29->657 1pg4A_ e.23.1.1 * 3.9e-128 30.8 %
:RPS:PFM   47->105 PF11930 * DUF3448 5e-08 47.4 %
:RPS:PFM   146->560 PF00501 * AMP-binding 9e-21 33.3 %
:HMM:PFM   128->562 PF00501 * AMP-binding 4.7e-64 28.0 411/418  
:HMM:PFM   45->105 PF11930 * DUF3448 4.6e-11 33.9 59/82  
:BLT:SWISS 12->660 ACSA1_RHIME e-138 42.3 %
:PROS 279->290|PS00455|AMP_BINDING
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68272.1 GT:GENE acsA3 GT:PRODUCT putative acetoacetyl-CoA synthetase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(711283..713301) GB:FROM 711283 GB:TO 713301 GB:DIRECTION - GB:GENE acsA3 GB:PRODUCT putative acetoacetyl-CoA synthetase GB:NOTE PF00501: AMP-binding enzyme GB:PROTEIN_ID BAC68272.1 LENGTH 672 SQ:AASEQ MTTPHPAPYPEPFFTPDPKSAAHSRIADFARWAARHQGAEGIQDPTDYRALYQWSVTDLEGFWAAVWEYFDIDATTEYEGVLAEETMPGARWFPGATLNYVHHALRNLQPDAPAITALDETGAGYEITGRELRARVASVAASLRDLGVAQGDRVVGYLPNTPHAVIAFLATASLGAVWSVCGQDYVPKAAADRFAQLEPTVLITADGYLFNGTTHDRRAASLELAVALPTLKATVLVDHVGLAWPEGGDLGLTVPWEDAATRAEYLTIAPVPFDHPLWVVFSSGTTGLPKGIVHGHGGVLLEHLKMLGLHTDLGIGDRLLWYTTTHWMMWNLVVSTLLTGATTCTYDGSPAPQARPDVLWELAARHKVTVFGTSPQYLLAMSKLGIAPSVYDLSAIRVVGCTGSALPASAYPWVRDHVGAGVQLASTSGGTDIVSGFAGSAATTPVWAGELSAPGLGVALAAYDEEGLPVTDRVGELVVTRPMPSMPLYFWNDPDGSRYRDAYFGAYPGVWRHGDWITLTSHGSVIVHGRSDATLNRNGVRLGSADIHDVVERLPEITEALVIGAEEPDGGYWMPLFVVLADGVGLDDSLRAKIRDAIRAGASPRHVPDEILAVPALPHTKTGKKLEVPVKRLLQGAPAEQVLNPSAVDNPDLIAYFARLGAERNKRSAHHT GT:EXON 1|1-672:0| BL:SWS:NREP 1 BL:SWS:REP 12->660|ACSA1_RHIME|e-138|42.3|636/650| PROS 279->290|PS00455|AMP_BINDING|PDOC00427| SEG 130->144|relrarvasvaaslr| BL:PDB:NREP 1 BL:PDB:REP 44->649|2p2mA|3e-51|28.8|591/638| RP:PDB:NREP 1 RP:PDB:REP 84->636|2d1sA|1e-45|14.2|530/538| RP:PFM:NREP 2 RP:PFM:REP 47->105|PF11930|5e-08|47.4|57/85|DUF3448| RP:PFM:REP 146->560|PF00501|9e-21|33.3|381/405|AMP-binding| HM:PFM:NREP 2 HM:PFM:REP 128->562|PF00501|4.7e-64|28.0|411/418|AMP-binding| HM:PFM:REP 45->105|PF11930|4.6e-11|33.9|59/82|DUF3448| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 47->648|1pg3A|1e-53|22.1|596/634|e.23.1.1| HM:SCP:REP 29->657|1pg4A_|3.9e-128|30.8|624/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 3130 OP:NHOMOORG 865 OP:PATTERN 22-2--48B9BBBA9A2153533762221155--31--2222-4424553111----1---433---2 1234A1-1--1---57444-37118B4444438BCBIEWK354B3112223-626442--538166G5782--------133B212211111-1-----2-111112221---------------2122221224244467111631121111--111111111112212111111111111142333---53233333323333333315334233446745111111114212222222222222221122-------------------------------------------------------------------------------------3---------2--4--3121--2---43-------52151131111122C7B31297A5724452243435-54443544368-4223444645456832235724324583333333331111833-----------------------------214A1-4663578897A73333449A777747A5CFGH913674435337697A8223112123---1---112B5415553433234333-1-2-3-11-33439554-----11111-111-11-11111131122-232231232222212222222122232---2533------32311112222222222-2212222222222221222212-132122222222221222222-----111-111111111111---111111222233522--------------1333333333331878896544599712131----1-1-11113444444433322111111111111--2-222222--------1-------------------------------------11- 1111ML3-621-3446944554454575545545444445544444444455683453433412222122222222222222222211-5429325222221476614538CB58774443573FA4D3Cw71C8C15366555625432842E3B65535D38541523A2352234292224462474351275664 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 647 STR:RPRED 96.3 SQ:SECSTR #################HTTccHHHHHHHHHEEEETTccEEEEEcccGGGTGGGcccEEEccTTTcHHHHTccTccHHHHTcETcEEccccccccccccHHHHHHHHHHHHHTcEEEEETTTcccEEEHHHHHHHHHHHHHHHHHHTccTTcEEEEEccccTTTHHHHHHHHHHTcEEEEEcTTccHHHHHHHHHHHcccEEEEcTTTHHHHHHHHHHcTTccEEEETTcccccTTcccEEEEEcccHHHHHHHTccTTccGGGcccccccTTTcEEEEEcccccccccccEEEEHHHHHHHHHHHTcTTTccccTcEEEEcccTTcHHHHHHHHHHHHTTcEEEEcccccccccHHHHHHHHHHTTEEEEEEcHHHHHHHHHcccGGGGcccTTccEEEEccccccHHHHHHHHHHTTccccccEEEEEcGGGccEEEEccTTcccTTcccEEcTTcEEEEEcTTTcccccTTccEEEEEEcTTcccEETTcHHTTcHHHHHHccTTccEEEEEEEEEcTTccEEEEEEGGGccccTTccccHHHHHHHHHTcTTEEEEEEEEEEETTTEEEEEEEEEEcTTccccHHHHHHHHHHHTTccGGGccTTcEEEcccccccTTccccHHHHHHHHHcHHTccEEEEEEEE#ETTEEEEEEEEEEEc####### DISOP:02AL 1-6, 8-10, 666-672| PSIPRED cccccccccccccccccHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccccccccccccccccHHHHHHHHHccccEEEEEEcccccEEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccHHHHHHcccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHccccEEEHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHHHHHHHHHccccEEEEccccHHHHccccccccccccccccccccccccEEEEEccccccccccccEEEEEcccccccccccccHHHHHHHcccccccccEEEEccEEEEccccEEEEEEccccEEEEccEEEcHHHHHHHHHHcccEEEEEEEEccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccccEEEEcccccccccccHHHHHHHHHHccccHHHHccccccHHHHHHHHHHHHHHHHHHHHcccc //