[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : agaA1
DDBJ      :agaA1        putative secreted alpha-galactosidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
b.42.2b.71.1c.1.8
:536 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->393 1uasA PDBj 1e-99 50.6 %
:BLT:PDB   411->533 1knmA PDBj 3e-34 56.9 %
:RPS:PDB   82->228 2bzuA PDBj 1e-36 15.7 %
:RPS:PDB   409->535 2dryA PDBj 6e-20 22.0 %
:RPS:SCOP  40->308 1ktbA2  c.1.8.1 * 1e-34 47.2 %
:RPS:SCOP  310->394 1uasA1  b.71.1.1 * 6e-17 35.3 %
:RPS:SCOP  410->536 1abrB1  b.42.2.1 * 2e-30 32.5 %
:HMM:SCOP  36->309 1sznA2 c.1.8.1 * 2.6e-98 45.6 %
:HMM:SCOP  310->396 1uasA1 b.71.1.1 * 4.4e-20 40.2 %
:HMM:SCOP  402->535 1knmA_ b.42.2.1 * 2.4e-35 48.0 %
:RPS:PFM   41->208 PF02065 * Melibiase 8e-23 41.7 %
:RPS:PFM   413->533 PF00652 * Ricin_B_lectin 9e-21 54.4 %
:HMM:PFM   409->533 PF00652 * Ricin_B_lectin 1.3e-30 46.6 116/125  
:HMM:PFM   45->236 PF02065 * Melibiase 6.3e-26 31.2 186/394  
:BLT:SWISS 41->393 AGAL_COFAR e-104 53.0 %
:BLT:SWISS 411->533 XYNA_STRLI 8e-34 56.9 %
:PROS 82->98|PS00512|ALPHA_GALACTOSIDASE
:TM
:REPEAT 3|417->445|459->488|502->535
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68338.1 GT:GENE agaA1 GT:PRODUCT putative secreted alpha-galactosidase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(781050..782660) GB:FROM 781050 GB:TO 782660 GB:DIRECTION - GB:GENE agaA1 GB:PRODUCT putative secreted alpha-galactosidase GB:NOTE PF00652: QXW lectin repeat GB:PROTEIN_ID BAC68338.1 LENGTH 536 SQ:AASEQ MTVPPSFLRPLSAAFAMLLLLVLAPALLVLRAAPPAQALDNGLARTPPMGWNDWNAFGCNVTEQLVKQTADYLVSSGLKGAGYQYVNIDDCWMTSARNSVGQLVPDPVKFPDGISGTAAYVHSKGLKLGIYESAGTATCQGYPGSLGHEQTDADSFASWGVDYLKYDNCNHQNVPDQQRYTAMRDALVNTGRPIVYSLCNWGLASVWTWGAGVGNSWRTTDDINVNFSTVVSIYKANVKLAPYAKPGAWNDPDMLEVGNGMSFTEDRSHFSLWSEMAAPLIAGTDLRKASAATLFLYGNKDVIAVDQDSLGKQGTEVSSSGGLHVLTKPLANGDVSVVLFNENSSAATITTSATAAGLPAASSYRLDNLWSHVVSSTGGSISASVPGHGSVMYRVSVGSGTSAGSTHPLVGASSNRCLDAYDNQTAPGTKIEIWDCGGANQAVTITAAGELRLYGGTQCLDAYDNGTTSGTKVQLYTCNGGANQKWSLNPNGTVTGTQSGLCLDVTGGDQASGNVNGTALELWTCNGGANQQWRLG GT:EXON 1|1-536:0| BL:SWS:NREP 2 BL:SWS:REP 41->393|AGAL_COFAR|e-104|53.0|353/378| BL:SWS:REP 411->533|XYNA_STRLI|8e-34|56.9|116/477| PROS 82->98|PS00512|ALPHA_GALACTOSIDASE|PDOC00443| TM:NTM 1 TM:REGION 11->33| NREPEAT 1 REPEAT 3|417->445|459->488|502->535| SEG 10->39|plsaafamllllvlapallvlraappaqal| SEG 344->356|ssaatittsataa| SEG 395->406|vsvgsgtsagst| BL:PDB:NREP 2 BL:PDB:REP 40->393|1uasA|1e-99|50.6|354/362| BL:PDB:REP 411->533|1knmA|3e-34|56.9|116/129| RP:PDB:NREP 2 RP:PDB:REP 82->228|2bzuA|1e-36|15.7|140/159| RP:PDB:REP 409->535|2dryA|6e-20|22.0|118/130| RP:PFM:NREP 2 RP:PFM:REP 41->208|PF02065|8e-23|41.7|163/225|Melibiase| RP:PFM:REP 413->533|PF00652|9e-21|54.4|114/125|Ricin_B_lectin| HM:PFM:NREP 2 HM:PFM:REP 409->533|PF00652|1.3e-30|46.6|116/125|Ricin_B_lectin| HM:PFM:REP 45->236|PF02065|6.3e-26|31.2|186/394|Melibiase| GO:PFM:NREP 2 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF02065|IPR000111| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02065|IPR000111| RP:SCP:NREP 3 RP:SCP:REP 40->308|1ktbA2|1e-34|47.2|269/293|c.1.8.1| RP:SCP:REP 310->394|1uasA1|6e-17|35.3|85/89|b.71.1.1| RP:SCP:REP 410->536|1abrB1|2e-30|32.5|117/140|b.42.2.1| HM:SCP:REP 36->309|1sznA2|2.6e-98|45.6|274/0|c.1.8.1|1/1|(Trans)glycosidases| HM:SCP:REP 310->396|1uasA1|4.4e-20|40.2|87/89|b.71.1.1|1/1|Glycosyl hydrolase domain| HM:SCP:REP 402->535|1knmA_|2.4e-35|48.0|127/0|b.42.2.1|1/1|Ricin B-like lectins| OP:NHOMO 544 OP:NHOMOORG 171 OP:PATTERN -------------------------------------------------------------------- 224-t---------1--------------------------1--1-1-2---11---2--22--E-2796-1----11----------3351--11-----3---3---4----------------------------------1--------------------------------------1--------------------------1---------------------4---------------------------------------------------------------------------------------------------------2-------------------------------------3--------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1---1---------1-----------------------------------------12----------------------------------3---------------------------------------------------------------------------------------------------------------------------------------3----------------------------1----------------------------------------------------------------------------------------------------------------31 ----22C--------113635533535----------------1114335232455432-----1-------2--1--1-------11-3241372--11-41----6E-2262323221322224122692-21312222222222221221322232---6442532241141-11-----45237844B------6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 497 STR:RPRED 92.7 SQ:SECSTR #######################################cccccccccEEEEcHHHHGGGccHHHHHHHHHHHHHHTHHHHEEccccccccccccTTcEEEEEEEEEEEEEEEccGGGGcccccEEEEEEEEcTTcccccccGGGcEETTTccHHccTTcGGGcccTTTccTTccHHHcccccccEEEETTTTEEEEEEcccEEEEEEEEccTTcccccccEEEEEEccHHHHHHHHHHHGGGccTTcEEEcccccTTccccHHHHHHHHHHHHHTTccEEEccccccccHHHHHHHccHHHHHHHTcTTccccEEEEEETTEEEEEEEETTTEEEEEEEEcccccEEEEEEHHHHTccTTccEEEEETTTEEEEEEccEEEEEEcTTEEEEEEEEcccccccEEEEEEEETTTccEEEEGGGcccTTccEEEEcccccGGcEEEcTTccEEETTTccEEEcccccccTTEEEEcccTTcGGGGcEEEETTEEEETTEEEEEEEEEcccccHccccccEEEEEEccccGGGcEEEc DISOP:02AL 1-2, 6-7| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccccccccHHHEEEcccHHHHHHHHHHHHHccHHHcccEEEEEEcccccccccccccEEEccHHcccHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEcccccHHHHHHHHHHHHHHHccEEEccccccccHHHHHHHccHHHHHHcccccccccEEEEEcccEEEEEEEcccccEEEEEEEccccccEEEEEEEEcccccccEEEEEEccccccccccccccccccccccEEcccccccccccccEEEEEEccccEEEEccccccccccEEEEEEcccccEEEEEEEcEEEEEccccEEEEEcccccccccEEEEEEEcccccEEEEEEEccEEEEccccEEEEEcccccccccccccEEEEEEccccccccEEcc //