[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : amiA
DDBJ      :amiA         putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->102 3k0lA PDBj 2e-06 25.6 %
:RPS:PDB   10->102 2a61A PDBj 2e-11 18.3 %
:RPS:SCOP  12->117 2fbiA1  a.4.5.28 * 5e-17 21.7 %
:HMM:SCOP  3->141 2fbkA1 a.4.5.28 * 5.4e-23 31.7 %
:HMM:PFM   39->93 PF01047 * MarR 8.4e-12 23.6 55/59  
:BLT:SWISS 41->102 HOSA_ECO11 8e-06 33.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68898.2 GT:GENE amiA GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1478786..1479232) GB:FROM 1478786 GB:TO 1479232 GB:DIRECTION - GB:GENE amiA GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC68898.2 LENGTH 148 SQ:AASEQ MPTPPPRRPHDLMQLLTRAERLAARHLQAVLDEDGCSLDAWRVLALLSDGEGHHMTAVAEAAFLPPATLTKLTDHLVDQNLVHRRVDPLDRRRILAYLTPRGRTYWRRLDREIRARWPVLSDGDDELLRALLDRLAGTLDGAAVESGL GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 41->102|HOSA_ECO11|8e-06|33.9|62/135| SEG 122->143|dgddellralldrlagtldgaa| BL:PDB:NREP 1 BL:PDB:REP 13->102|3k0lA|2e-06|25.6|90/136| RP:PDB:NREP 1 RP:PDB:REP 10->102|2a61A|2e-11|18.3|93/142| HM:PFM:NREP 1 HM:PFM:REP 39->93|PF01047|8.4e-12|23.6|55/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 12->117|2fbiA1|5e-17|21.7|106/136|a.4.5.28| HM:SCP:REP 3->141|2fbkA1|5.4e-23|31.7|139/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----1--1-----------------1------1----------------------------------1--------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----11-------------------------1----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 78.4 SQ:SECSTR #THHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHTTcccHHHHHH############################### DISOP:02AL 1-4,142-149| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccc //