[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : aph1
DDBJ      :aph1         putative aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   197->233 3hamA PDBj 2e-05 43.2 %
:RPS:PDB   41->238 3dxqB PDBj 3e-06 19.2 %
:RPS:SCOP  42->237 1j7iA  d.144.1.6 * 6e-15 21.6 %
:HMM:SCOP  20->273 1nd4A_ d.144.1.6 * 4.6e-45 31.6 %
:RPS:PFM   196->241 PF01636 * APH 4e-06 47.8 %
:HMM:PFM   47->263 PF01636 * APH 4.6e-31 30.5 210/238  
:HMM:PFM   258->273 PF07470 * Glyco_hydro_88 0.00086 43.8 16/336  
:BLT:SWISS 182->241 KKA8_ECOLX 2e-05 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68535.1 GT:GENE aph1 GT:PRODUCT putative aminoglycoside phosphotransferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(976138..977037) GB:FROM 976138 GB:TO 977037 GB:DIRECTION - GB:GENE aph1 GB:PRODUCT putative aminoglycoside phosphotransferase GB:NOTE PF01636: Phosphotransferase enzyme family GB:PROTEIN_ID BAC68535.1 LENGTH 299 SQ:AASEQ MATGRTADTRPAIDAALVRRLVETQFPQWAELSLELLDPAGSDHVIYRLGEELSVRLPRHAGAAGQARKEAEWLPRLAPHLPLAIPVPAGVGEPDLDYPWPWAVSRWLDGEVATAEALADSSEAAVELAQFLTALQRFAPEDVPAEGALKNVAVRPLADRDRATRAAIAKVDDVFDTAAMTELWDAALSAPGWGRPPVWFHGDFHTGNLLTFDGRLSAVIDFGELGIGDPARDLTIAFTLMSARSRAAFRAALDVDDATWARGRGWALATGLNAYTTYAAVNPRVAAQTTRQITEALIG GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 182->241|KKA8_ECOLX|2e-05|33.3|60/271| SEG 158->169|adrdratraaia| SEG 242->252|sarsraafraa| BL:PDB:NREP 1 BL:PDB:REP 197->233|3hamA|2e-05|43.2|37/299| RP:PDB:NREP 1 RP:PDB:REP 41->238|3dxqB|3e-06|19.2|172/280| RP:PFM:NREP 1 RP:PFM:REP 196->241|PF01636|4e-06|47.8|46/221|APH| HM:PFM:NREP 2 HM:PFM:REP 47->263|PF01636|4.6e-31|30.5|210/238|APH| HM:PFM:REP 258->273|PF07470|0.00086|43.8|16/336|Glyco_hydro_88| RP:SCP:NREP 1 RP:SCP:REP 42->237|1j7iA|6e-15|21.6|190/260|d.144.1.6| HM:SCP:REP 20->273|1nd4A_|4.6e-45|31.6|247/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 74 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ----2---------1--12-1---1-11111-----11-1-1-222-1------1--2---1--1-1312---------------------------------------------------------------------1----1-------------------------------------------------111111---1-111-1-----111--------------2-------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------1---112--1---11---1--------------------------------------1-1---11----1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 73.9 SQ:SECSTR ###############HHHHHHccTHHHHccGGGcccEEEcccccEEEEETTEEEEEEccHHHHHHHHHHHHHHHHHHHHTTccTTcccEE##cEEEEcTTTccEEEccTTcEEcHHHHHHcTTHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHTTccccccTTHHHHHHHTTHHHHHHHHHHHTccTcccccEEEcccccGGGEEcEccccTEEcccHTTcEEcHHHHHHHHH############################################################# DISOP:02AL 1-8| PSIPRED ccccccccccccccHHHHHHHHHHHcccccccccEEcccccccccEEEEccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccEEEEcccccccEEEEccEEEEEEEccccccccHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcc //