[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : aveBI
DDBJ      :aveBI        dTDP-L-oleandrose transferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  132/915 : Eukaryota  38/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:412 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->387 2iyaA PDBj 6e-63 38.6 %
:RPS:PDB   4->404 3d0qA PDBj 8e-31 20.2 %
:RPS:SCOP  14->388 1iirA  c.87.1.5 * 1e-23 20.8 %
:HMM:SCOP  1->408 1rrvA_ c.87.1.5 * 2.9e-72 29.2 %
:RPS:PFM   14->53 PF03033 * Glyco_transf_28 3e-04 45.0 %
:RPS:PFM   261->387 PF00201 * UDPGT 1e-13 30.7 %
:HMM:PFM   240->379 PF00201 * UDPGT 8.3e-19 27.2 136/501  
:HMM:PFM   6->103 PF03033 * Glyco_transf_28 2.7e-12 25.3 91/139  
:BLT:SWISS 4->387 YJIC_BACSU 2e-58 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68655.1 GT:GENE aveBI GT:PRODUCT dTDP-L-oleandrose transferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1203604..1204842 GB:FROM 1203604 GB:TO 1204842 GB:DIRECTION + GB:GENE aveBI GB:PRODUCT dTDP-L-oleandrose transferase GB:NOTE avermectin gene cluster, PF00201: UDP-glucoronosyl and UDP-glucosyl transferase dTDP-L-oleandrose transferase (glycosyltransferase) GB:PROTEIN_ID BAC68655.1 LENGTH 412 SQ:AASEQ MSDHFLFMSAPFWGHVFPSLAVAEELVHRGHHVTFVTGAEMADAVRSVGADFLRYESAFEGVDMYRLMTEAEPNAIPMTLYDEGMSMLRSVEEHVGKDVPDLVAYDIATSLNVGRVLAASWSRPAMTVIPLFASNGRFSTMQSVLDPDSAQVSAPPPRFSEQMELFGLGALVPRLAELLVSRGITEPVDDFLSGPEDFNLVCLPRAFQYAGDTFDERFAFVGPCLGKRRGLGEWTPPGSGHPVVLISLGTVFNRQLSFFRTFVRAFTDVPVHVVISLGKGVDPDVLRPLPPNVEVHRWVPHHAVLEHARALVTHGGTGSVMEALHAGCPVLVMPLSRDAQVTGRRIAELGLGRMVQPEEVTATTLRRHVLDIISDDAITRQVRQMQRATVEAGGALRAADETERFLRRTRRH GT:EXON 1|1-412:0| BL:SWS:NREP 1 BL:SWS:REP 4->387|YJIC_BACSU|2e-58|35.6|360/392| BL:PDB:NREP 1 BL:PDB:REP 4->387|2iyaA|6e-63|38.6|365/392| RP:PDB:NREP 1 RP:PDB:REP 4->404|3d0qA|8e-31|20.2|366/369| RP:PFM:NREP 2 RP:PFM:REP 14->53|PF03033|3e-04|45.0|40/138|Glyco_transf_28| RP:PFM:REP 261->387|PF00201|1e-13|30.7|127/278|UDPGT| HM:PFM:NREP 2 HM:PFM:REP 240->379|PF00201|8.3e-19|27.2|136/501|UDPGT| HM:PFM:REP 6->103|PF03033|2.7e-12|25.3|91/139|Glyco_transf_28| GO:PFM:NREP 5 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF03033|IPR004276| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF03033|IPR004276| GO:PFM GO:0030259|"GO:lipid glycosylation"|PF03033|IPR004276| GO:PFM GO:0008152|"GO:metabolic process"|PF00201|IPR002213| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF00201|IPR002213| RP:SCP:NREP 1 RP:SCP:REP 14->388|1iirA|1e-23|20.8|342/382|c.87.1.5| HM:SCP:REP 1->408|1rrvA_|2.9e-72|29.2|394/0|c.87.1.5|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 330 OP:NHOMOORG 170 OP:PATTERN -------------------------------------------------------------------- 112-1----------------1---3------2111-1231312-11--23------1--4-1-528122-----------1-----------------------3--------------------------------------412--1--1-----------1-----1----------------------32222234222233331-3313223---1---------1--------------------1----------------------------------11-------------------------------------22111111----41-----------1------------------------1---------21----------------------1-1--111-1--------1------1----------------------------------------------------------------------111121--------------1---------------------------------------------------------------1--------2------------------------------11------------------------------------------1-1------1-111--------------1---------21122-11111111111111111--1----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------- ----1---------------------------------------------2113--1---------------------------------------------------1-743558--------1--1113------------45-1---1----2-14---15-24936-3438-1-------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 412 STR:RPRED 100.0 SQ:SECSTR HcEEEEEEccccTTccHHHHHHHHHHHHTTcEEEEEEccccHHHHHTTTccEEEccTTccHHHHHHHHHHHcTTTTTTGGGcccccGGGTGGGcccccGGGGHHHHHHHHHHHHHHGHHHHHHHHGGGHHHHHHHHHHcccEEEEETTcHHHHHHHHHHTccEEEEcccccccTTHHHHHTTcHHHHHTTcccccccEEEEcccGGGcccccTTTTEEEEccccccccccccccccccccccEEEEEcHHHHHHHccGGHHHHHHHTTcccEEEEEcTTccccGGGccccTTEEEcccccHHHHHTTEEEEEEcccHHHHHHHHHTTccEEEcccTTcTTcHHHHHHHHHHTcEcEEEccTTTccHHHHHHHHHcHHHHHHHHHHHHHHTcccHHHHHHHHHHHHcTcccHc DISOP:02AL 387-394| PSIPRED ccccEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHHcccEEEEEccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccEEEEEccHHHccccccccccEEEEccccccccccHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHcccccEEEEccccHHHHHccccEEEEcccHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //