[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : aveBII
DDBJ      :aveBII       dTDP-glucose 4,6-dehydratase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  819/915 : Eukaryota  174/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:355 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->317 1r66A PDBj e-128 69.4 %
:RPS:PDB   2->311 1e7rA PDBj 7e-49 20.6 %
:RPS:SCOP  2->317 1bxkA  c.2.1.2 * 5e-93 49.5 %
:HMM:SCOP  1->316 1gy8A_ c.2.1.2 * 1.8e-95 46.5 %
:RPS:PFM   1->236 PF01370 * Epimerase 2e-51 48.9 %
:HMM:PFM   1->239 PF01370 * Epimerase 5.3e-71 43.2 229/238  
:BLT:SWISS 1->324 STRE_STRGR e-107 60.7 %
:PROS 134->162|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68656.1 GT:GENE aveBII GT:PRODUCT dTDP-glucose 4,6-dehydratase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1204748..1205815) GB:FROM 1204748 GB:TO 1205815 GB:DIRECTION - GB:GENE aveBII GB:PRODUCT dTDP-glucose 4,6-dehydratase GB:NOTE avermectin gene cluster GB:PROTEIN_ID BAC68656.1 LENGTH 355 SQ:AASEQ MTGGAGFIGSHFVRRLLTGAYPAFTGAEVVVLDKLTYAGRLENLAPVLGSPSLIFVHGDICDGPLVADLMDGSDMVVHFAAESHVDRSVADAAEFVRTNVLGTHTLLRAATDAAVDRFVYISTDEVYGSIDSGSWTEDAPLEPNSPYSASKASSDLLARSFHRTHGLPVIITRCSNNYGPHQFPEKLIPRFVTHLLNGTKVPLYGDGENVRDWLHVDDHCRGIALVAERGRPGEIYHIGGGTELSNRELTARLLDLLGVDWSMVEPVTDRKGHDRRYSLDISKISAELGYAPRVPFEEGLAQTVQWYVENRTLWEPLTARPELPVSDGASGAETARSRPLPAGRRPPRPWPAASA GT:EXON 1|1-355:0| BL:SWS:NREP 1 BL:SWS:REP 1->324|STRE_STRGR|e-107|60.7|321/328| PROS 134->162|PS00061|ADH_SHORT|PDOC00060| SEG 335->354|arsrplpagrrpprpwpaas| BL:PDB:NREP 1 BL:PDB:REP 1->317|1r66A|e-128|69.4|317/322| RP:PDB:NREP 1 RP:PDB:REP 2->311|1e7rA|7e-49|20.6|286/314| RP:PFM:NREP 1 RP:PFM:REP 1->236|PF01370|2e-51|48.9|225/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 1->239|PF01370|5.3e-71|43.2|229/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 2->317|1bxkA|5e-93|49.5|311/341|c.2.1.2| HM:SCP:REP 1->316|1gy8A_|1.8e-95|46.5|310/383|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 5369 OP:NHOMOORG 1062 OP:PATTERN 11111-324443455223121342A5547773396338132225846869676133322332233-13 7BI5922533522256677-7A339A999995777745575ABA36212464755421116421777768333332232222846864AB8419111--54546999AA7--------------363654876A64EFFCE-11D5D99BBBA4455874565587AB9C85654455765473331122423555656B96658599737665445945223631112118A2111111111111113---1611144233133522433522323223432333433344242243241111111111111412333222232-957776777565914433425271-7213244B8672334121234359B5569-----67FE7673965AF54655565657-CCDJDNCC5E725995HKCILIEF83843646B9AA45-5555555574557FC8-----------------------------1544325A743B8978B7666688BF99994768D665523553B42442365525537554552233332546697397E94CC9A7BAB8ECB9B7G7CA8A98GB943531454552-323321323133565758456545163455434333444533234--19436------45654555665555563-6656475554654345547535444346377767666586874555255554-623343333434--1-545552333835352222222222222224223214334635455698435566367723332233334355222222524636465653334434--A68899AA111111113-1----------1-1---13-1-----11335222216B5 -122334-21114672211-11-2121------111-1-1111---1111353511112111323-1--2-111211-1111121223-24221312111221668-8J6C765492221223474262BD5-354332-31333123324114443455634552-345O4A748656*DAA55RNVZ1YI68A7879 -----------------------3--------------------------------------------------------------------------------------------------------------------------------------------------12--- STR:NPRED 334 STR:RPRED 94.1 SQ:SECSTR EETTTcHHHHHHHHHHTTTTTHHHcTTEEEEcccTTTGGGTGGGTTTTTcTTEEccTTcHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccTccGGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTcHHHHHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHHHHHHTccTTcccEEEcccccEEHHHHHHccEEEEETTccccccccccccHHHHHHTTccccccHHHHHHHHHHHHHHTcHHHHHHHHccTTTTccccccccc##################### DISOP:02AL 318-355| PSIPRED cccccccHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHccccEEEEEEccccHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHHHccccEEEEEcccEEEEEEEHHHHHHHHHHHHHccccccEEEEcccccEEHHHHHHHHHHHHcccccEEEEcccccccHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHHccccccccccccccccHHHcccccccccccccccccc //