[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : aveBIV
DDBJ      :aveBIV       dTDP-4-keto-6-deoxy-L-hexose 4-reductase
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  102/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:343 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->200 2hrzA PDBj 1e-08 35.4 %
:BLT:PDB   193->276 2q1uB PDBj 5e-06 32.9 %
:RPS:PDB   26->342 1e7rA PDBj 5e-19 14.8 %
:RPS:SCOP  29->343 1sb8A  c.2.1.2 * 3e-27 17.2 %
:HMM:SCOP  28->342 1eq2A_ c.2.1.2 * 9.8e-43 33.0 %
:RPS:PFM   29->257 PF01370 * Epimerase 2e-11 33.6 %
:HMM:PFM   29->266 PF01370 * Epimerase 2e-38 29.1 230/238  
:BLT:SWISS 28->339 GALE_METJA 1e-10 25.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68658.1 GT:GENE aveBIV GT:PRODUCT dTDP-4-keto-6-deoxy-L-hexose 4-reductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1206837..1207868 GB:FROM 1206837 GB:TO 1207868 GB:DIRECTION + GB:GENE aveBIV GB:PRODUCT dTDP-4-keto-6-deoxy-L-hexose 4-reductase GB:NOTE avermectin gene cluster GB:PROTEIN_ID BAC68658.1 LENGTH 343 SQ:AASEQ MGRFSVCPPRPTGILKSMLTTGMCDRPLVVVLGASGYIGSAVAAELARWPVLLRLVARRPGVVPPGGAAETETRTADLTAASEVALAVTDADVVIHLVARLTQGAAWRAAESDPVAERVNVGVMHDVVAALRSGRRAGPPPVVVFAGSVYQVGRPGRVDGSEPDEPVTAYARQKLDAERTLKSATVEGVLRGISLRLPTVYGAGPGPQGNGVVQAMVLRALADEALTVWNGSVVERDLVHVEDVAQAFVSCLAHADALAGRHWLLGSGRPVTVPHLFGAIAAGVSARTGRPAVPVTAVDPPAMATAADFHGTVVDSSAFRAVTGWRPRLSLQEGLDHMVAAYV GT:EXON 1|1-343:0| BL:SWS:NREP 1 BL:SWS:REP 28->339|GALE_METJA|1e-10|25.2|286/305| SEG 291->308|pavpvtavdppamataad| BL:PDB:NREP 2 BL:PDB:REP 64->200|2hrzA|1e-08|35.4|130/335| BL:PDB:REP 193->276|2q1uB|5e-06|32.9|82/335| RP:PDB:NREP 1 RP:PDB:REP 26->342|1e7rA|5e-19|14.8|298/314| RP:PFM:NREP 1 RP:PFM:REP 29->257|PF01370|2e-11|33.6|220/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 29->266|PF01370|2e-38|29.1|230/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 29->343|1sb8A|3e-27|17.2|302/341|c.2.1.2| HM:SCP:REP 28->342|1eq2A_|9.8e-43|33.0|294/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 159 OP:NHOMOORG 124 OP:PATTERN ------------------------3--1122-------------------1--11111111------1 -1--1---------1-1---------------------11-111----------------11---211-2------------1--------------------------------------------------1---11-----1-11--11--------------------1------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1----------1---1--1--1----------1-11-212-321-------211222112-----24233----------------1---------------------------------1--------222121--11111131111-21-1---------------1-----2-1111---------1-1-----12---1---1-----11-----1--12-1--------------------------------1-------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------1----------1-----------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------1-1-----------1------------------------------------------------111-----------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 341 STR:RPRED 99.4 SQ:SECSTR #cccccTccTTcccccccTTccccccEEEEEETTTcHHHHHHHHHHTTcEEEEEEcccccTTEEEEcccTTTccTTcHHHHHHHHHHHcccEEEEcccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTcEEEcEEEEEccGGGccTTccccccGGGTTcGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHccHHHHHTccTTcccEEEcccccEEHHHHHHHHHHHHTcccEEEEETTccccccccccccHHHHHHTTccccccHHHHHHHHHHHH# DISOP:02AL 1-23| PSIPRED cccEEcccccccHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEEccccHHHHHHHHHcccEEEEccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHHcccccEEEcccEEEEEEEEHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHEEccHHHHHHHHcccccccHHHHHHHHHHHHc //