[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : bcp1
DDBJ      :bcp1         putative bacterioferritin comigratory protein
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  689/915 : Eukaryota  70/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->129 2cx3B PDBj 9e-15 37.7 %
:RPS:PDB   7->154 3drnB PDBj 1e-23 33.1 %
:RPS:SCOP  26->152 2cv4A1  c.47.1.10 * 4e-20 25.2 %
:HMM:SCOP  1->153 1x0rA1 c.47.1.10 * 3.1e-44 38.2 %
:RPS:PFM   7->107 PF00578 * AhpC-TSA 8e-20 47.0 %
:RPS:PFM   94->138 PF05622 * HOOK 7e-04 35.6 %
:HMM:PFM   7->130 PF00578 * AhpC-TSA 1.6e-32 40.2 122/124  
:BLT:SWISS 4->152 PRXQ_ARATH 7e-23 37.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68784.1 GT:GENE bcp1 GT:PRODUCT putative bacterioferritin comigratory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1352919..1353386 GB:FROM 1352919 GB:TO 1353386 GB:DIRECTION + GB:GENE bcp1 GB:PRODUCT putative bacterioferritin comigratory protein GB:NOTE PF00578: AhpC/TSA family GB:PROTEIN_ID BAC68784.1 LENGTH 155 SQ:AASEQ MTRRVDVGDKVEDFVLPDETGTPRQLSDLVADGPVVLFFYPAALTAGCTAEACHFRDLAAEFAAAGARPVGISGDPVDRQQEFAGQHTLGFPLLSDEDGTIRERFGVKRGFSLAPTKRVTFVIAEDRTVLEVVRSELRMSAHADRALTALRAHRS GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 4->152|PRXQ_ARATH|7e-23|37.8|148/216| BL:PDB:NREP 1 BL:PDB:REP 5->129|2cx3B|9e-15|37.7|122/159| RP:PDB:NREP 1 RP:PDB:REP 7->154|3drnB|1e-23|33.1|145/150| RP:PFM:NREP 2 RP:PFM:REP 7->107|PF00578|8e-20|47.0|100/122|AhpC-TSA| RP:PFM:REP 94->138|PF05622|7e-04|35.6|45/582|HOOK| HM:PFM:NREP 1 HM:PFM:REP 7->130|PF00578|1.6e-32|40.2|122/124|AhpC-TSA| GO:PFM:NREP 5 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| GO:PFM GO:0000226|"GO:microtubule cytoskeleton organization"|PF05622|IPR008636| GO:PFM GO:0005737|"GO:cytoplasm"|PF05622|IPR008636| GO:PFM GO:0008017|"GO:microtubule binding"|PF05622|IPR008636| RP:SCP:NREP 1 RP:SCP:REP 26->152|2cv4A1|4e-20|25.2|127/150|c.47.1.10| HM:SCP:REP 1->153|1x0rA1|3.1e-44|38.2|152/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 1126 OP:NHOMOORG 800 OP:PATTERN 33--1-333333333312222-1-42243121-------------1-1-11-1----1111312--22 4132211111111122222-22112222222222223222132411211111333112--22213233322-111111---11111121111-1111--1-222162111--------------12222212223111121---3-42443334444333333213344432223223223322341111-1111111111111211121111111111111111------2211111111111111111111-------------------------------------------------------------------------11-------1-1-1---1111-1---111-----------111-2--1-122211111121111111111111111111-111---11-11111111111111111112111211-111111111111111122211111111111111-11111-1111-11-1111-1122-1333222222221111223322222222311111-11111111221122112342311111111111223111-----1-1-111-1-21-1-112-1234--111111111111111111111-11111111121211111111111111112111121--111111-----11111121111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1111111111111111111111111111111111112--111111111111111111111----1---111111111111111111111111111111-1-112222-------------------1----------------211221-11121- ----A6--------1-11--111-1----1111--11-------11-111111-111-----11--1------1-111-1------11-21212-21112--111----1-----------------------------------------------------------------32116111133112-12221-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 100.0 SQ:SECSTR cEEEccTTccccccEEEETTccEEEGGGTTTTcEEEEEEcccTTcHHHHHHHHHHHHTHHHHGGGcEEEEEEEcccHHHHHHHHHHHTcccEEEEcTTcHHHHHTTcccccccccEcEEEEEEcTTccEEEEEEccccTTHHHHHHHHHHHHHHc DISOP:02AL 1-2| PSIPRED cccccccccccccEEEEcccccEEEHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccEEEEEcccHHHHHHccccccccccccccEEEEEccccEEEEEEEccccccccHHHHHHHHHHHcc //