[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : celA1
DDBJ      :celA1        putative secreted endo-1,4-beta-glucanase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
b.2.2b.29.1
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->259 2nlrA PDBj e-104 75.7 %
:BLT:PDB   270->373 1exgA PDBj 2e-23 44.2 %
:RPS:PDB   39->257 3b7mA PDBj 4e-24 32.4 %
:RPS:PDB   270->370 2cwrA PDBj 1e-10 19.1 %
:RPS:SCOP  40->257 1h0bA  b.29.1.11 * 1e-55 32.9 %
:RPS:SCOP  269->375 1exgA  b.2.2.1 * 3e-18 43.0 %
:HMM:SCOP  38->259 1oa4A_ b.29.1.11 * 1.2e-78 46.8 %
:HMM:SCOP  267->375 1exhA_ b.2.2.1 * 2.7e-33 51.4 %
:RPS:PFM   110->254 PF01670 * Glyco_hydro_12 8e-17 42.8 %
:RPS:PFM   279->364 PF00553 * CBM_2 7e-10 45.3 %
:HMM:PFM   109->258 PF01670 * Glyco_hydro_12 4.2e-58 46.7 150/156  
:HMM:PFM   273->372 PF00553 * CBM_2 1.9e-32 54.0 100/101  
:BLT:SWISS 42->257 GUN_ASPAC 4e-20 33.3 %
:BLT:SWISS 270->373 GUX_CELFI 6e-23 44.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68265.1 GT:GENE celA1 GT:PRODUCT putative secreted endo-1,4-beta-glucanase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 702503..703630 GB:FROM 702503 GB:TO 703630 GB:DIRECTION + GB:GENE celA1 GB:PRODUCT putative secreted endo-1,4-beta-glucanase GB:NOTE PF01670: Glycosyl hydrolase family 12 GB:PROTEIN_ID BAC68265.1 LENGTH 375 SQ:AASEQ MRPSPPHARSARGLFGALLTALVSLAALLTTASVAQADTSICEPFGSTTIQGRYVVQNNRWGTSEAQCITATDSGFRITQADGSVPTNGAPKSYPSVYNGCHYTNCSPGTSLPAQLSTVSSAPTSISYSYVSNAMYDAAYDIWLDPTPRTDGVNRTEIMVWFNKVGSVQPVGSQVGTATVAGRQWQVWSGNNGSNDVLSFVAPSAITSWSFDVMDFVRQAVSRGLAQNSWYLTSVQAGFEPWQNGAGLAVTSFSSTVNTGGGNPGDPGSPTACKVAYATNVWQGGFTADVTVTNTGSSPVNGWKLAFTLPAGQQITSSWSAGVSPSSGAVTASSLAYNAQIATGGRVSFGFQGSYSGTFAAPAGFSLNGAACTTA GT:EXON 1|1-375:0| BL:SWS:NREP 2 BL:SWS:REP 42->257|GUN_ASPAC|4e-20|33.3|207/237| BL:SWS:REP 270->373|GUX_CELFI|6e-23|44.2|104/484| TM:NTM 1 TM:REGION 12->34| SEG 17->35|alltalvslaallttasva| SEG 165->176|vgsvqpvgsqvg| SEG 316->334|tsswsagvspssgavtass| BL:PDB:NREP 2 BL:PDB:REP 38->259|2nlrA|e-104|75.7|222/222| BL:PDB:REP 270->373|1exgA|2e-23|44.2|104/110| RP:PDB:NREP 2 RP:PDB:REP 39->257|3b7mA|4e-24|32.4|210/216| RP:PDB:REP 270->370|2cwrA|1e-10|19.1|94/97| RP:PFM:NREP 2 RP:PFM:REP 110->254|PF01670|8e-17|42.8|145/153|Glyco_hydro_12| RP:PFM:REP 279->364|PF00553|7e-10|45.3|86/94|CBM_2| HM:PFM:NREP 2 HM:PFM:REP 109->258|PF01670|4.2e-58|46.7|150/156|Glyco_hydro_12| HM:PFM:REP 273->372|PF00553|1.9e-32|54.0|100/101|CBM_2| GO:PFM:NREP 5 GO:PFM GO:0000272|"GO:polysaccharide catabolic process"|PF01670|IPR002594| GO:PFM GO:0008810|"GO:cellulase activity"|PF01670|IPR002594| GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF00553|IPR001919| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00553|IPR001919| GO:PFM GO:0030246|"GO:carbohydrate binding"|PF00553|IPR001919| RP:SCP:NREP 2 RP:SCP:REP 40->257|1h0bA|1e-55|32.9|216/226|b.29.1.11| RP:SCP:REP 269->375|1exgA|3e-18|43.0|107/110|b.2.2.1| HM:SCP:REP 38->259|1oa4A_|1.2e-78|46.8|222/222|b.29.1.11|1/1|Concanavalin A-like lectins/glucanases| HM:SCP:REP 267->375|1exhA_|2.7e-33|51.4|109/0|b.2.2.1|1/1|Carbohydrate-binding domain| OP:NHOMO 200 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- ----J---------11111-11--1-111111--------4-------7-----------33--E--77-8-----------------------------------------------------------------1-------D------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------11------------------------------------------------------2------------------------------1------------------------------------------------------------------------------------------------------------------ -1-------------1-2112222314-------------------12132232-1131------------------------------143--13---------------------------------------------------------------------------------------------2----B38A- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 86.9 SQ:SECSTR #####################################cEEEccTTcEEEETTTEEEEcccccccccEEEEEETTTccEEEEEEccccccccccccEEEEEcccTEEcTTccccccGGGcccEEEEEEEEcccccEEEEEEEEEEEccTTccTTcEEEEEEEEEEEcccccccEEEEEEEETTEEEEEEEEEcccEEEEEEEEcccccEEEEEHHHHHHHHHHHTcccTTcEEEEEEEEEEEEEccTTcEEEEEEEEEcc##########cccEEEEEEEEEcccEEEEEEEEEEcccccEcccEEEEEEcTTcEEEEEEcEEEEEETTEEEEEEcTTccccccccEEEEEEEEEccccccEEEEEEETTEEEE## DISOP:02AL 1-11, 262-264, 374-375| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccEEEEEcccccEEEcccccccccccEEcccEEcccccccccccccccEEEccccccEEEEEEEEcccEEEEEEEEEEEcccccccccccEEEEEEEccccccccccEEEEEEEEcccEEEEEEcccccEEEEEEEEccccEEEEEEHHHHHHHHHHcccccccEEEEEEEEEccccccccEEEEcccEEEcccccccccccccccEEEEEEEEEEccccEEEEEEEEEcccccEEcEEEEEEEccccEEEEEEEEEEEEcccEEEEEccccccccccccEEEEEEEEccccccccccEEEEcccccccc //