[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : celS1
DDBJ      :celS1        putative cellulose-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.2.2c.23.11
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->33 1x38A PDBj 2e-04 56.2 %
:BLT:PDB   49->131 1exgA PDBj 6e-16 41.0 %
:RPS:PDB   41->131 2cwrA PDBj 1e-11 25.0 %
:RPS:SCOP  1->33 1ex1A2  c.23.11.1 * 4e-06 54.5 %
:RPS:SCOP  36->131 1exgA  b.2.2.1 * 4e-14 36.8 %
:HMM:SCOP  36->135 1exhA_ b.2.2.1 * 1.6e-25 40.0 %
:RPS:PFM   43->131 PF00553 * CBM_2 1e-10 43.8 %
:HMM:PFM   42->133 PF00553 * CBM_2 9e-27 40.2 92/101  
:HMM:PFM   1->31 PF01915 * Glyco_hydro_3_C 0.00066 29.0 31/211  
:BLT:SWISS 41->110 GUNA_MICBI 4e-20 54.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68266.1 GT:GENE celS1 GT:PRODUCT putative cellulose-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 703943..704353 GB:FROM 703943 GB:TO 704353 GB:DIRECTION + GB:GENE celS1 GB:PRODUCT putative cellulose-binding protein GB:NOTE PF00553: Cellulose binding domain GB:PROTEIN_ID BAC68266.1 LENGTH 136 SQ:AASEQ MTWMKSASQEPINDGDGKAALFPYGYGLTYDATDPTPTQGACTAQFRTVSSWQGGYQAEATVKNTGSAALTGWTVDWDPAGSTITSLWNGSLTTAQDRATVRNAAFNGSLRPGATTPFGFTANGPTDTPAPHCTSS GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 41->110|GUNA_MICBI|4e-20|54.3|70/456| BL:PDB:NREP 2 BL:PDB:REP 2->33|1x38A|2e-04|56.2|32/602| BL:PDB:REP 49->131|1exgA|6e-16|41.0|83/110| RP:PDB:NREP 1 RP:PDB:REP 41->131|2cwrA|1e-11|25.0|84/97| RP:PFM:NREP 1 RP:PFM:REP 43->131|PF00553|1e-10|43.8|89/94|CBM_2| HM:PFM:NREP 2 HM:PFM:REP 42->133|PF00553|9e-27|40.2|92/101|CBM_2| HM:PFM:REP 1->31|PF01915|0.00066|29.0|31/211|Glyco_hydro_3_C| GO:PFM:NREP 3 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF00553|IPR001919| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00553|IPR001919| GO:PFM GO:0030246|"GO:carbohydrate binding"|PF00553|IPR001919| RP:SCP:NREP 2 RP:SCP:REP 1->33|1ex1A2|4e-06|54.5|33/214|c.23.11.1| RP:SCP:REP 36->131|1exgA|4e-14|36.8|95/110|b.2.2.1| HM:SCP:REP 36->135|1exhA_|1.6e-25|40.0|100/0|b.2.2.1|1/1|Carbohydrate-binding domain| OP:NHOMO 124 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ---1I----------------1--1------1--------7-------5-----------35--K--582B-----------------------------------------------------------------1-------C-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------7-------------------------------------------------------------------------------------------------------------------------------------2------------------------------B------------------------------------------------------------------------------------------------------------------ -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 96.3 SQ:SECSTR cccccTTTccccccccEEEccccccccccTTcccccccccccEEEEEEEEEcccEEEEEEEEEEccccEEcccEEEEEcTTcEEEEEEcEEEEEETTEEEEEEcTTcEccccccEEEEEEEEEccccccEE##### DISOP:02AL 4-5, 130-136| PSIPRED cEEEEEcccccccccccEEEEEccccccccccccccccccccEEEEEEEEEccccEEEEEEEEEcccccccccEEEEEEcccEEcccEEEEEEEcccEEEEEccccccccccccEEEEEEEEcccccccccEEEEc //