[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : clpP4
DDBJ      :clpP4        putative ATP-dependent Clp protease proteolytic subunit 1
Swiss-Prot:CLPP1_STRAW  RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;         EC=3.4.21.92;AltName: Full=Endopeptidase Clp 1;

Homologs  Archaea  0/68 : Bacteria  884/915 : Eukaryota  146/199 : Viruses  1/175   --->[See Alignment]
c.14.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->200 2cbyG PDBj 7e-53 60.7 %
:RPS:PDB   28->201 2cbyB PDBj 5e-53 60.4 %
:RPS:SCOP  38->202 1tg6A1  c.14.1.1 * 2e-29 48.5 %
:HMM:SCOP  20->210 2f6iA1 c.14.1.1 * 7.1e-65 51.1 %
:RPS:PFM   32->201 PF00574 * CLP_protease 1e-55 60.0 %
:HMM:PFM   31->202 PF00574 * CLP_protease 2.8e-73 58.7 172/182  
:BLT:SWISS 1->217 CLPP1_STRAW e-122 100.0 %
:PROS 122->135|PS00382|CLP_PROTEASE_HIS

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68856.1 GT:GENE clpP4 GT:PRODUCT putative ATP-dependent Clp protease proteolytic subunit 1 GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1435653..1436306 GB:FROM 1435653 GB:TO 1436306 GB:DIRECTION + GB:GENE clpP4 GB:PRODUCT putative ATP-dependent Clp protease proteolytic subunit 1 GB:NOTE PF00574: Clp protease GB:PROTEIN_ID BAC68856.1 LENGTH 217 SQ:AASEQ MTPLTTGWHPALSPRAEEGDTPPSRFDDHLAAQLLAQRIVLLGTQVDEVSANRVCAQLLLLSAEDSRTDISLYINSPGGSVTAGLAIYDTMRLIPNDVSTLAMGFAASMGQFLLSVGAAGKRFALPNARIMMHQPSAGIGGTTADIEIQAENLEFTKKAIERITAEHTGQSEETISRDGDRDRWFTAEQAKEYGMVDRVVESLDDVRPTASRRRMGL GT:EXON 1|1-217:0| SW:ID CLPP1_STRAW SW:DE RecName: Full=ATP-dependent Clp protease proteolytic subunit 1; EC=3.4.21.92;AltName: Full=Endopeptidase Clp 1; SW:GN Name=clpP1; OrderedLocusNames=SAV_1146; SW:KW ATP-binding; Complete proteome; Cytoplasm; Hydrolase;Nucleotide-binding; Protease; Serine protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->217|CLPP1_STRAW|e-122|100.0|217/217| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0008236|"GO:serine-type peptidase activity"|Serine protease| PROS 122->135|PS00382|CLP_PROTEASE_HIS|PDOC00358| BL:PDB:NREP 1 BL:PDB:REP 28->200|2cbyG|7e-53|60.7|163/167| RP:PDB:NREP 1 RP:PDB:REP 28->201|2cbyB|5e-53|60.4|164/170| RP:PFM:NREP 1 RP:PFM:REP 32->201|PF00574|1e-55|60.0|170/179|CLP_protease| HM:PFM:NREP 1 HM:PFM:REP 31->202|PF00574|2.8e-73|58.7|172/182|CLP_protease| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00574|IPR001907| GO:PFM GO:0006508|"GO:proteolysis"|PF00574|IPR001907| RP:SCP:NREP 1 RP:SCP:REP 38->202|1tg6A1|2e-29|48.5|165/184|c.14.1.1| HM:SCP:REP 20->210|2f6iA1|7.1e-65|51.1|190/0|c.14.1.1|1/1|ClpP/crotonase| OP:NHOMO 1748 OP:NHOMOORG 1031 OP:PATTERN -------------------------------------------------------------------- 1112522222222222222-222222222222222244442445442222222222242233423225532222222211121111111111111121-11112211122222222222222222111111111112222211111344344433444444444432444444444444444411111112211222222222233232224411222121111122222233222121111211222111111111111121111111112122111112111111111111111111112221111111111-111111111112211122112311211111221111211112212111111111111111211121111111221111111111111111111211121111122213332332333331122111211111112222222222221121111111111111111111111111111111111111111211111121111112211112121211111111111111431132111111111111111111112111111111111111111111111111112211111111111111111111111111111111111111111111211111121211111111111111111111111221111111111--1111111121111111121111111111212212212131112111111211111111111111111111111111121211212111111112111111111111111222311111111111111111111111111111111111111211111111111111112222222222222222--------------------------1111111111121 22----122---1111111111111111111111111111111-1111111111111111111----------1---------------1211111111111-111-1D-21111211-1--111-1--151-1-111--11111-1-111-1-1--111111211-111512225866*78969JDKK19C6631117 ----------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 99.1 SQ:SECSTR ##cccTHHHHHHHcccccEccccccccHHHHHHHHHTTEEEEcccccHHHHHHHHHHHHHHHHHcTTccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEETHHHHHHHTccTTcEEEcTTcEEEccccGGcccccccccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTcEEEHHHHHHHTcccEEcccHHHHHHHHHHHHHHH DISOP:02AL 1-9, 12-16, 18-20| PSIPRED ccccccccccccccEEEEcccccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHcccHHHHcccccccccccccccccc //