[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cpt
DDBJ      :cpt          putative chloramphenicol 3-O phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->175 1grqA PDBj 2e-64 65.7 %
:HMM:SCOP  1->177 1qhxA_ c.37.1.3 * 3.7e-10 18.1 %
:RPS:PFM   2->171 PF07931 * CPT 4e-24 44.0 %
:HMM:PFM   2->175 PF07931 * CPT 4.6e-73 52.0 173/174  
:BLT:SWISS 4->175 CPT_STRVL 7e-64 65.7 %
:PROS 4->15|PS01075|ACETATE_KINASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68587.1 GT:GENE cpt GT:PRODUCT putative chloramphenicol 3-O phosphotransferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1050455..1050985 GB:FROM 1050455 GB:TO 1050985 GB:DIRECTION + GB:GENE cpt GB:PRODUCT putative chloramphenicol 3-O phosphotransferase GB:NOTE similar to Cpt(Q56148) chloramphenicol-producing Streptomyces venezuelae. Streptomyces coelicolor A3(2) has different resistance mechanism (probably efflux, CmlR), PF07931: Chloramphenicol phosphotransferase-like protein GB:PROTEIN_ID BAC68587.1 LENGTH 176 SQ:AASEQ MADVIVLNGGSSSGKSGIVRCLQAVLPDPWLALGTDTLVDAMPASMQASDAGIEFAPDGEVIVGPEFRTLEAAWIEGVAAMARAGARVIVDEVFLGGADSQQRWQKALRDLRVLWVGVRCDGAVAAGREIARGDRVIGMAASQADVVHRGVVYDLEVDTTHAESMECARAIATHVR GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 4->175|CPT_STRVL|7e-64|65.7|172/178| PROS 4->15|PS01075|ACETATE_KINASE_1|PDOC00826| SEG 77->88|gvaamaragarv| BL:PDB:NREP 1 BL:PDB:REP 4->175|1grqA|2e-64|65.7|172/178| RP:PFM:NREP 1 RP:PFM:REP 2->171|PF07931|4e-24|44.0|168/174|CPT| HM:PFM:NREP 1 HM:PFM:REP 2->175|PF07931|4.6e-73|52.0|173/174|CPT| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF07931|IPR012853| GO:PFM GO:0016740|"GO:transferase activity"|PF07931|IPR012853| HM:SCP:REP 1->177|1qhxA_|3.7e-10|18.1|177/0|c.37.1.3|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------1--1--------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 97.7 SQ:SECSTR ###EEEEEEcTTccHHHHHHHHHHHccccEEEccHHHHHHHccGGGGTcTTccEEETTTEEEccHHHHHHHHHHHHHHHHHHHTTcEEEEEEccTTTHHHHHHHHHHHTTccEEEEEEEccHHHHHHHHHHHTcccTTHHHHHTTGGGTTccccEEEETTTccHHHHHHHHHTTc# DISOP:02AL 129-135| PSIPRED ccEEEEEEccccccHHHHHHHHHHHccccEEEHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHccccEEEEEEEccHHHHHHHHHHcccccccccHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHcc //