[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : crcB1
DDBJ      :crcB1        putative camphor resistance protein CrcB
Swiss-Prot:CRCB1_STRAW  RecName: Full=Protein crcB homolog 1;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:HMM:PFM   3->116 PF02537 * CRCB 9.8e-33 39.8 113/117  
:BLT:SWISS 1->124 CRCB1_STRAW 2e-31 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69030.1 GT:GENE crcB1 GT:PRODUCT putative camphor resistance protein CrcB GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1631650..1632024) GB:FROM 1631650 GB:TO 1632024 GB:DIRECTION - GB:GENE crcB1 GB:PRODUCT putative camphor resistance protein CrcB GB:NOTE PF02537: CrcB-like protein GB:PROTEIN_ID BAC69030.1 LENGTH 124 SQ:AASEQ MNWLLVIAGAMVGAPLRYVTDRMVQLRHDAVFPWGTFAINVTGCLVLGLLTGAASAGVASPHLELLLGTGLCGALTTYSTFSYETLRLTETGAGFYAAANAIASVAAGLGAAFAGVWFAQALWA GT:EXON 1|1-124:0| SW:ID CRCB1_STRAW SW:DE RecName: Full=Protein crcB homolog 1; SW:GN Name=crcB1; OrderedLocusNames=SAV_1320; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|CRCB1_STRAW|2e-31|100.0|124/124| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 4->26| TM:REGION 42->64| TM:REGION 99->121| SEG 41->52|vtgclvlglltg| SEG 63->77|lelllgtglcgaltt| SEG 93->119|agfyaaanaiasvaaglgaafagvwfa| HM:PFM:NREP 1 HM:PFM:REP 3->116|PF02537|9.8e-33|39.8|113/117|CRCB| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------11------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //