[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : crcB2
DDBJ      :crcB2        putative camphor resistance protein CrcB
Swiss-Prot:CRCB2_STRAW  RecName: Full=Protein crcB homolog 2;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->144 PF02537 * CRCB 2.6e-30 37.8 111/117  
:BLT:SWISS 1->124 CRCB2_STRAW 4e-45 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69032.1 GT:GENE crcB2 GT:PRODUCT putative camphor resistance protein CrcB GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1632260..1632736) GB:FROM 1632260 GB:TO 1632736 GB:DIRECTION - GB:GENE crcB2 GB:PRODUCT putative camphor resistance protein CrcB GB:NOTE PF02537: CrcB-like protein GB:PROTEIN_ID BAC69032.1 LENGTH 158 SQ:AASEQ MTVPHPESVGEPGIAVRAPARRRSAWHGQAPVVAVVALGGGIGGTARYAAALLWPTQSGGFPWTTFWVNVVGCAVIGVFMVVITDVWPAHRLVRPFFGTGVLGGFTTFSTYAVDIQKLVDAGHPRTALAYLAATLLAALAAVRLAATAARRVLVRRRR GT:EXON 1|1-158:0| SW:ID CRCB2_STRAW SW:DE RecName: Full=Protein crcB homolog 2; SW:GN Name=crcB2; OrderedLocusNames=SAV_1322; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|CRCB2_STRAW|4e-45|100.0|124/158| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 26->48| TM:REGION 67->89| TM:REGION 95->117| TM:REGION 128->149| SEG 28->51|gqapvvavvalgggiggtaryaaa| SEG 96->110|ffgtgvlggfttfst| SEG 125->157|rtalaylaatllaalaavrlaataarrvlvrrr| HM:PFM:NREP 1 HM:PFM:REP 34->144|PF02537|2.6e-30|37.8|111/117|CRCB| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----1-------------------1----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23, 157-158| PSIPRED cccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //