[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : crtY
DDBJ      :crtY         lycopene cyclase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:397 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->348 2gmhA1 c.3.1.2 * 3.9e-15 22.6 %
:RPS:PFM   109->289 PF05834 * Lycopene_cycl 3e-08 35.9 %
:HMM:PFM   5->383 PF05834 * Lycopene_cycl 4.8e-114 34.7 366/374  
:BLT:SWISS 185->289 CRTY_ESCVU 1e-04 33.3 %
:PROS 50->65|PS00024|HEMOPEXIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68731.1 GT:GENE crtY GT:PRODUCT lycopene cyclase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1287518..1288711) GB:FROM 1287518 GB:TO 1288711 GB:DIRECTION - GB:GENE crtY GB:PRODUCT lycopene cyclase GB:NOTE crt gene cluster, PF05834: Lycopene cyclase protein GB:PROTEIN_ID BAC68731.1 LENGTH 397 SQ:AASEQ MLEADVAIVGAGAAGLSLAHRLACPVRGAPRISVVLLEAPPGPLRPPRRTWCFWERGPGRYDAAVTASWQRLRVRAPGGRPIEGDITPLRYKMIRSDDFEALMAHDLALSGGVQRVEATVEAVEGVPGGAEVYAYTAAGRPLPVRARWVFDSRPLGSLPAARTTLLQHFHGWFVRSDLPVFDPGTVELMDFRTPQPPRGLSFGYVLPTGRRQALVEYTEFSPAVLPRSAYEAALRHYTRDILHLPGLEIVSTETGVIPMTDAPFARQTAASVFRIGAAGGATRPSTGYTFAAVQRQTRAVAAALCRGRRPLPPPAHSARSRAMDAVLLRALDSGRIGGAAFFARLFSRVPMERLLRFLDGCTHLHEDLSIGVHTPVLPMLRSAAELPYLPRRPFPGP GT:EXON 1|1-397:0| BL:SWS:NREP 1 BL:SWS:REP 185->289|CRTY_ESCVU|1e-04|33.3|102/100| PROS 50->65|PS00024|HEMOPEXIN|PDOC00023| SEG 4->23|advaivgagaaglslahrla| SEG 291->303|aavqrqtravaaa| RP:PFM:NREP 1 RP:PFM:REP 109->289|PF05834|3e-08|35.9|167/368|Lycopene_cycl| HM:PFM:NREP 1 HM:PFM:REP 5->383|PF05834|4.8e-114|34.7|366/374|Lycopene_cycl| GO:PFM:NREP 2 GO:PFM GO:0016117|"GO:carotenoid biosynthetic process"|PF05834|IPR008671| GO:PFM GO:0016705|"GO:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen"|PF05834|IPR008671| HM:SCP:REP 1->348|2gmhA1|3.9e-15|22.6|261/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 21 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------1---------------11-----1131-----------2------------------11111------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 393-397| PSIPRED cccccEEEEcccHHHHHHHHHHHHHcccccccEEEEEcccccccccccccEEEEccccccHHHHHHHHcccEEEEEccccccccccccccEEEEcHHHHHHHHHHHHHHcccEEEEHHHHHHHHccccccEEEEEEEcccEEEEEEEEEEEcccccccccccccEEEEEEEEEEEEcccccccccEEEEEEcccccccccEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHcccccccccccc //