[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cspD2
DDBJ      :cspD2        putative cold shock protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  696/915 : Eukaryota  77/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:67 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->65 2i5mX PDBj 9e-20 60.9 %
:RPS:PDB   1->66 1c9oA PDBj 1e-20 55.4 %
:RPS:SCOP  1->66 1c9oA  b.40.4.5 * 4e-21 55.4 %
:HMM:SCOP  1->68 1h95A_ b.40.4.5 * 2.7e-25 54.4 %
:RPS:PFM   2->65 PF00313 * CSD 2e-18 65.6 %
:HMM:PFM   1->66 PF00313 * CSD 2.2e-34 56.1 66/67  
:BLT:SWISS 1->67 CSPF_STRCO 1e-32 88.1 %
:PROS 15->34|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68603.1 GT:GENE cspD2 GT:PRODUCT putative cold shock protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1071654..1071857) GB:FROM 1071654 GB:TO 1071857 GB:DIRECTION - GB:GENE cspD2 GB:PRODUCT putative cold shock protein GB:NOTE PF00313: 'Cold-shock' DNA-binding domain GB:PROTEIN_ID BAC68603.1 LENGTH 67 SQ:AASEQ MASGTVKWFNSEKGFGFIEQDGGGPDVFAHYSNIASSGFRELQEGQKVNFDVTQGQKGPQAENITPA GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|CSPF_STRCO|1e-32|88.1|67/67| PROS 15->34|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 1->65|2i5mX|9e-20|60.9|64/66| RP:PDB:NREP 1 RP:PDB:REP 1->66|1c9oA|1e-20|55.4|65/66| RP:PFM:NREP 1 RP:PFM:REP 2->65|PF00313|2e-18|65.6|64/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF00313|2.2e-34|56.1|66/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->66|1c9oA|4e-21|55.4|65/66|b.40.4.5| HM:SCP:REP 1->68|1h95A_|2.7e-25|54.4|68/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2547 OP:NHOMOORG 784 OP:PATTERN ------------------------31152223----------------------------------11 553-711333312123222-24223322222233335474233432311223354213--443-5468862--111111-21311122-----------1-2131--442---------------11112122311-----------1-----------------------------------32122--2123666666666666676213333667211436233333365-33333333333332222235-21331111-4311333212212561111111--------------1111111111111-11222111312222333323311-1445211-5-1-2-11--11241-342111112112-133341111143B55B554544633233333233-5537544549415554655997974422232565455333333333323333333------------1111111111111----22222155555666566533324468444434557586512444221--------3212323231111111224233-4526-----1----666334653555561551-------------------1---1114433564349B433333332332333333411-121311122245445737557755-66-568555577557755765645444556555544544455555575545555319747876576881122-----6665245452221222111111123422423334445555666656666555522222222224448444444444433333333332222115-----------------1---1----1--------1-------2311122212--- --11----------1-------1---------------------------1----------------------------------------------------11---5--3212122-111317A1715J3-51A-1-28--32122215-15-32-11233C22-121-1221--11A21-223144-4421----1 ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEcEEEEEGGGccccccccccTTcEEEEEEEEETTEEEEEEEEEc DISOP:02AL 61-62| PSIPRED ccccEEEEEEccccEEEEcccccccEEEEEEEEEccccccccccccEEEEEEEccccccEEEEEEEc //