[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cvnB1
DDBJ      :cvnB1        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.1d.110.7
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   17->132 1a0kA PDBj 3e-17 16.5 %
:RPS:SCOP  17->132 1a0kA  d.110.1.1 * 2e-17 16.5 %
:HMM:SCOP  7->138 1j3wA_ d.110.7.1 * 2.1e-31 40.5 %
:RPS:PFM   20->96 PF03259 * Robl_LC7 3e-11 48.0 %
:HMM:PFM   17->108 PF03259 * Robl_LC7 7.8e-24 37.4 91/91  
:HMM:PFM   90->135 PF11290 * DUF3090 0.00033 29.5 44/171  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68963.1 GT:GENE cvnB1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1557218..1557667 GB:FROM 1557218 GB:TO 1557667 GB:DIRECTION + GB:GENE cvnB1 GB:PRODUCT hypothetical protein GB:NOTE multi-component regulatory system-1, PF03259: Roadblock/LC7 domain GB:PROTEIN_ID BAC68963.1 LENGTH 149 SQ:AASEQ MRKRYVMTEQVQSGPRLDWLLDGLVDRIPEIRCAIVLSGDGLLIGKSKNLRRDDAEHLSAVGSGMHSLARGAARHFHGGEVQQTVIQMDRAFLFVTAAGRGARLAAIASEQVDVGMMAFEMGTLVKQVGQYLSAAPRVETPSAGHIQDA GT:EXON 1|1-149:0| SEG 97->108|aagrgarlaaia| RP:PDB:NREP 1 RP:PDB:REP 17->132|1a0kA|3e-17|16.5|115/130| RP:PFM:NREP 1 RP:PFM:REP 20->96|PF03259|3e-11|48.0|75/90|Robl_LC7| HM:PFM:NREP 2 HM:PFM:REP 17->108|PF03259|7.8e-24|37.4|91/91|Robl_LC7| HM:PFM:REP 90->135|PF11290|0.00033|29.5|44/171|DUF3090| RP:SCP:NREP 1 RP:SCP:REP 17->132|1a0kA|2e-17|16.5|115/130|d.110.1.1| HM:SCP:REP 7->138|1j3wA_|2.1e-31|40.5|131/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 102 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ----5----------111-------111111-1---6112-4452---1-----------64--565AA96---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 79.9 SQ:SECSTR ################HHHHTccccTTcccccEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTTccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEEEEcccEEETTccHHHHHHHHHHHHHHHHTT############## DISOP:02AL 1-5, 7-12, 136-149| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHEEEEEcccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccc //