[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cvnB3
DDBJ      :cvnB3        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   13->128 1a0kA PDBj 1e-13 18.4 %
:RPS:SCOP  12->128 1skoB  d.110.7.1 * 6e-19 16.7 %
:HMM:SCOP  6->134 1j3wA_ d.110.7.1 * 1.7e-22 37.0 %
:RPS:PFM   21->103 PF03259 * Robl_LC7 3e-09 41.5 %
:HMM:PFM   13->104 PF03259 * Robl_LC7 4.9e-25 38.5 91/91  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69343.1 GT:GENE cvnB3 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1999819..2000253) GB:FROM 1999819 GB:TO 2000253 GB:DIRECTION - GB:GENE cvnB3 GB:PRODUCT hypothetical protein GB:NOTE multi-component regulatory system-3, PF03259: Roadblock/LC7 domain GB:PROTEIN_ID BAC69343.1 LENGTH 144 SQ:AASEQ MASDAPTGHVSDLDWLMSGLVQRVPHTTSAVLLSCDGLVKSVHGLDPDSADHMAALASGLYSLGRSAGIRFGDGGDVRQVVVELDSTLLFVSTAGSGTCLAVLAGREADAAVLGYEMAMLVKSVRPYLMTAPRQAAAQPPAMRP GT:EXON 1|1-144:0| SEG 131->143|aprqaaaqppamr| RP:PDB:NREP 1 RP:PDB:REP 13->128|1a0kA|1e-13|18.4|114/130| RP:PFM:NREP 1 RP:PFM:REP 21->103|PF03259|3e-09|41.5|82/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 13->104|PF03259|4.9e-25|38.5|91/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 12->128|1skoB|6e-19|16.7|114/116|d.110.7.1| HM:SCP:REP 6->134|1j3wA_|1.7e-22|37.0|127/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 110 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----4----------1111-11--1111111111115112-4452---1-----------64--575BA96---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 80.6 SQ:SECSTR ############HHHHTccccTTcTcccEEEEEETTccEEEcTTcccccHHHHHHHHHHHHcTTccTTTcEEETTTEEEEEEEEETTTEEEEEETTEEEEEEEcccEEETTccHHHHHHHHHHHHHHH################ DISOP:02AL 1-9, 131-144| PSIPRED ccccccccccHHHHHHHHHHHHHccHHEEEEEEcccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccc //