[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cvnC1
DDBJ      :cvnC1        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->124 PF05331 * DUF742 3e-15 54.5 %
:HMM:PFM   11->124 PF05331 * DUF742 2.9e-36 49.5 111/114  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68964.1 GT:GENE cvnC1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1557660..1558034 GB:FROM 1557660 GB:TO 1558034 GB:DIRECTION + GB:GENE cvnC1 GB:PRODUCT hypothetical protein GB:NOTE multi-component regulatory system-1, PF05331: Protein of unknown function (DUF742) GB:PROTEIN_ID BAC68964.1 LENGTH 124 SQ:AASEQ MPEPRWLDDAEAGRHLRPYAITGGRTRHSQHTFTLITLVVARSAHEFDHDHLEPESVQILELCRDRAVAVAEIAAHLDLPVSVVKILCGDLLNASLVIVQAPPGQEDQPSVELIERVMDGIRQL GT:EXON 1|1-124:0| RP:PFM:NREP 1 RP:PFM:REP 12->124|PF05331|3e-15|54.5|110/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 11->124|PF05331|2.9e-36|49.5|111/114|DUF742| OP:NHOMO 64 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----4-------------------------------4----334----1-----------21--3549885---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccccccccccccccEEEEcccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHccEEEEEccccccccccHHHHHHHHHHHHcc //