[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cvnC2
DDBJ      :cvnC2        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->137 PF05331 * DUF742 2e-14 50.0 %
:HMM:PFM   20->137 PF05331 * DUF742 6.3e-41 57.7 111/114  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69291.1 GT:GENE cvnC2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1944205..1944618) GB:FROM 1944205 GB:TO 1944618 GB:DIRECTION - GB:GENE cvnC2 GB:PRODUCT hypothetical protein GB:NOTE multi-component regulatory system-2, PF05331: Protein of unknown function (DUF742) GB:PROTEIN_ID BAC69291.1 LENGTH 137 SQ:AASEQ MTEDRPGSALQAGSQWYDNEAGPLVRPYAMTGGRTKPGPTGVRFDLIALVTLDTAAPRVDDDTSLGPEHRALIDLCRVETQSVAELAAGADLPVGVVRVLLGDLLELGCVTVSRPVPPAQLPDERILREVIAGLRAL GT:EXON 1|1-137:0| SEG 92->110|lpvgvvrvllgdllelgcv| RP:PFM:NREP 1 RP:PFM:REP 21->137|PF05331|2e-14|50.0|110/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 20->137|PF05331|6.3e-41|57.7|111/114|DUF742| OP:NHOMO 13 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------111--------------------1112311---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED cccccccccccccccccccccccccccEEEEcccccccccccccEEEEEEEEccccccccccccccHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHccEEEEEccccccccccHHHHHHHHHHHHcc //