[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cvnC3
DDBJ      :cvnC3        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:106 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  47->104 2d1hA1  a.4.5.50 * 5e-04 26.3 %
:RPS:PFM   1->103 PF05331 * DUF742 1e-17 53.4 %
:HMM:PFM   2->105 PF05331 * DUF742 1.1e-38 53.8 104/114  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69342.1 GT:GENE cvnC3 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1999445..1999765) GB:FROM 1999445 GB:TO 1999765 GB:DIRECTION - GB:GENE cvnC3 GB:PRODUCT hypothetical protein GB:NOTE multi-component regulatory system-3, PF05331: Protein of unknown function (DUF742) GB:PROTEIN_ID BAC69342.1 LENGTH 106 SQ:AASEQ MRPYTVSNGRTRPTTALDLLSQVMATGVTPLGYLGPEHTQALELCRAPVSVAEVAAHLKLPAAVTKVLLSDLVDCGALTTKPPEFYHNPTDRSLLEAVLDGLRRQL GT:EXON 1|1-106:0| RP:PFM:NREP 1 RP:PFM:REP 1->103|PF05331|1e-17|53.4|103/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 2->105|PF05331|1.1e-38|53.8|104/114|DUF742| RP:SCP:NREP 1 RP:SCP:REP 47->104|2d1hA1|5e-04|26.3|57/102|a.4.5.50| OP:NHOMO 66 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----5-------------------------------4-11-323----------------11--4549A76---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 106-107| PSIPRED cccEEEEcccccccccccEEEEEEEEcccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHcc //