[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cvnD1
DDBJ      :cvnD1        putative ATP/GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  73/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->123 1x3sA PDBj 8e-06 35.1 %
:RPS:PDB   14->149 3ea5C PDBj 2e-05 18.5 %
:RPS:SCOP  14->156 1zd9A1  c.37.1.8 * 2e-04 17.6 %
:HMM:SCOP  10->195 1e2kA_ c.37.1.1 * 1.5e-19 28.4 %
:HMM:PFM   18->183 PF03029 * ATP_bind_1 7.1e-26 31.7 161/238  
:BLT:SWISS 14->140 Y1339_METJA 6e-09 35.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68965.1 GT:GENE cvnD1 GT:PRODUCT putative ATP/GTP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1558015..1558614 GB:FROM 1558015 GB:TO 1558614 GB:DIRECTION + GB:GENE cvnD1 GB:PRODUCT putative ATP/GTP-binding protein GB:NOTE multi-component regulatory system-1 GB:PROTEIN_ID BAC68965.1 LENGTH 199 SQ:AASEQ MVSVSSEPVMPTALKILIAGGFGVGKTTMVGSVSEVPPLETEERMTAVSLGVDDLSGVEGKKSTTVAMDFGRITIAPELVLYLFGTPGQDRFWFMWDDLATGALAAIVLADTRRLDASFASIDFFEARDIPFAVGVNCFDGRRDCSAEQVRTALDLDPSTPVLLCDVRDRGSSKSVLLAVLEAARAQAAARLAPLGGGQ GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 14->140|Y1339_METJA|6e-09|35.5|107/154| SEG 177->195|llavleaaraqaaarlapl| BL:PDB:NREP 1 BL:PDB:REP 12->123|1x3sA|8e-06|35.1|94/175| RP:PDB:NREP 1 RP:PDB:REP 14->149|3ea5C|2e-05|18.5|119/169| HM:PFM:NREP 1 HM:PFM:REP 18->183|PF03029|7.1e-26|31.7|161/238|ATP_bind_1| RP:SCP:NREP 1 RP:SCP:REP 14->156|1zd9A1|2e-04|17.6|125/164|c.37.1.8| HM:SCP:REP 10->195|1e2kA_|1.5e-19|28.4|183/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 165 OP:NHOMOORG 81 OP:PATTERN ----------------11--------------------1-111------------------------- ----9----------1111-11--111111111111511214352---1-----------53--465BDA6------------1-111----------------------------------------------2-11122---3----2---11----------1-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----1----------------11111---------------------------------------------------------------11--------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111---------------------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 69.3 SQ:SECSTR ###########EEEEEEEEccTTccHHHHHHHHHHcccccccccccccHHHHcTTcccHHHHHcEEEEEEEEEETTEEEEEEEEEEcccGGGcTTGGGGGTTccEEEEEEETTcHHHHHTHHHHHHHHTccEEEEEEcTTccccccccT################################################## DISOP:02AL 1-11, 185-199| PSIPRED ccccccccccccEEEEEEEEcccccHHHHHHHHHcccccccccccEEcccccccccccccccEEEEEEEEEEEEEcccEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccccccccc //