[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : cvnD3
DDBJ      :cvnD3        putative ATP/GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  71/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->151 1e2kA_ c.37.1.1 * 1.5e-16 28.0 %
:HMM:PFM   2->169 PF03029 * ATP_bind_1 3.5e-32 36.2 163/238  
:BLT:SWISS 29->97 Y765_METTH 1e-07 38.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69341.1 GT:GENE cvnD3 GT:PRODUCT putative ATP/GTP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1998868..1999416) GB:FROM 1998868 GB:TO 1999416 GB:DIRECTION - GB:GENE cvnD3 GB:PRODUCT putative ATP/GTP-binding protein GB:NOTE multi-component regulatory system-3 GB:PROTEIN_ID BAC69341.1 LENGTH 182 SQ:AASEQ MAGGFGVGKTTFVGAVSEIAPLSTEELLTTVGAATDNLDGIENKVETTVAMDFGRITLDPEHVLYLFGTPGQQRFWFMWDELSEGALGAVILADTRRLEDCFAAVDFFEQRGLAFIVAINDFDGGYRYDPAEVRAAIDLDPHIPVVRCDARISSSGVQTLLTLVRHLLAHAPATAPSHGAHT GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 29->97|Y765_METTH|1e-07|38.8|67/152| SEG 2->15|aggfgvgkttfvga| HM:PFM:NREP 1 HM:PFM:REP 2->169|PF03029|3.5e-32|36.2|163/238|ATP_bind_1| HM:SCP:REP 1->151|1e2kA_|1.5e-16|28.0|150/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 158 OP:NHOMOORG 75 OP:PATTERN ----------------11-------------------------------------------------- ----9----------1111-11--111111111111511214352---1-----------53--465BDA6------------1-111----------------------------------------------2-11122---3----2---11----------1-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------11111-------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111---------------------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 168-182| PSIPRED ccccccccHHHHHHHHHccccccccHHHHHHHHcccccccccccEEEEEEEEEEEEEEcccEEEEEEEccccHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccccccccc //