[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : dak1
DDBJ      :dak1         putative dihydroxyacetone kinase subunit 1
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  301/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
c.119.1
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->329 1oi2A PDBj 2e-65 43.8 %
:RPS:PDB   2->325 3ct4A PDBj 3e-96 41.7 %
:RPS:SCOP  11->329 1oi2A  c.119.1.2 * 9e-98 46.8 %
:HMM:SCOP  10->330 1oi2A_ c.119.1.2 * 1.9e-129 53.9 %
:RPS:PFM   16->326 PF02733 * Dak1 2e-82 52.3 %
:HMM:PFM   16->329 PF02733 * Dak1 1.5e-107 45.0 313/326  
:BLT:SWISS 1->329 DHAK_ECOLI 7e-74 44.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68995.1 GT:GENE dak1 GT:PRODUCT putative dihydroxyacetone kinase subunit 1 GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1594134..1595126 GB:FROM 1594134 GB:TO 1595126 GB:DIRECTION + GB:GENE dak1 GB:PRODUCT putative dihydroxyacetone kinase subunit 1 GB:NOTE PF02733: Dak1 domain GB:PROTEIN_ID BAC68995.1 LENGTH 330 SQ:AASEQ MKMLINVAETVVADALRGMAAAHPELTVDVEKRVIVRRDAPVAGKVGLVSGGGSGHEPLHGGFVGPGMLSAACPGEVFTSPVPDQMVRAAAAVDSGAGVLFIVKNYTGDVLNFDMAAELAEDEGVQVAKVLVNDDVAVTDSLYTAGRRGTGATLFVEKIAGAAAEEGAPLQRVEALARQVNENARSFGVALSACTTPAKGSPTFDLPDGELELGVGIHGEPGRERRAMMTSREIADFSVHAILEDLNPSNPVLVLVNGMGATPLLELYGFNAEVQRVLVERGVPVARTLVGNYVTSLDMAGASVTLCQVDEELLRLWDAPVSTPGLRWGM GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 1->329|DHAK_ECOLI|7e-74|44.4|329/356| SEG 44->62|gkvglvsgggsgheplhgg| SEG 160->168|agaaaeega| BL:PDB:NREP 1 BL:PDB:REP 11->329|1oi2A|2e-65|43.8|308/336| RP:PDB:NREP 1 RP:PDB:REP 2->325|3ct4A|3e-96|41.7|314/318| RP:PFM:NREP 1 RP:PFM:REP 16->326|PF02733|2e-82|52.3|310/317|Dak1| HM:PFM:NREP 1 HM:PFM:REP 16->329|PF02733|1.5e-107|45.0|313/326|Dak1| GO:PFM:NREP 2 GO:PFM GO:0004371|"GO:glycerone kinase activity"|PF02733|IPR004006| GO:PFM GO:0006071|"GO:glycerol metabolic process"|PF02733|IPR004006| RP:SCP:NREP 1 RP:SCP:REP 11->329|1oi2A|9e-98|46.8|308/336|c.119.1.2| HM:SCP:REP 10->330|1oi2A_|1.9e-129|53.9|321/347|c.119.1.2|1/1|DAK1/DegV-like| OP:NHOMO 692 OP:NHOMOORG 472 OP:PATTERN ----------------------------1-1------------------------------------- ---1211-----1-1----------3-------222-211----213-1221323--2----122341221---------1-1----------1-----------1------------------------------11122-------1--------------------1------------------------22222222122222222----2221---111222223-1-111111111111112111211--12-----22--11-21---2112222--2--------2------2--2---2--2-122---2222-1--111111112211---111-11-1----1-------1---211--1---------------11----------122-222-24-11111-1114--311-233552331----1------2----------1111---2-----------------------------------------11111121111121222211111---------2----1-3--1----211----------11----------1-11111--------------11-----------------------------11-----------------------------------------22--11-1111121211--111211111-111111112221---2----------------111-111---111111111111-------------1--2-1112-1--------1----------1----------------11-------------1------1--------------------1--------------1----------1--------11------------------- ----11--21---112322111111121111111111211--11111136223333211122314112-1111132212211111111-112312132221--111-11141111121-1111111111371-113-11-1-111-111111-1111111--11111--25211--1118111112114221111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 328 STR:RPRED 99.4 SQ:SECSTR #ccccccGGGHHHHHHHHHHHHTTTEEEcGGGccEEEEccccccccEEEEEEEEccTTTTGGGcccTcccEEEEEEETccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHTTccEEEEEEcccccccccTTcccccccTTHHHHHHHHHHHHHTTccHHHHHHHHHHHHTTEEEEEEEcccccETTTcEEcccccccEEEETccTTcccccEEEEcccHHHHHHHHHHHHHHHHcTTcEEEEEEEEcccccHHHHHHHHHHHHHHHHTTTcEEEEEEEEcccccTTccEEEEEEEEccHHHHHHHTccccccccEEc# DISOP:02AL 330-331| PSIPRED cccccccHHHHHHHHHHHHHHHccccEEcccccEEEEccccccccEEEEEccccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEEccccccccccccccccccEEEEEEEEccccccEEEccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEccHHHHHHHccccccHHHcccc //