[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : ddh
DDBJ      :ddh          putative dimethylarginine dimethylaminohydrolase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  66/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
d.126.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->252 1h70A PDBj 2e-38 37.1 %
:RPS:PDB   4->254 2ci3A PDBj 3e-50 33.3 %
:RPS:SCOP  4->253 1h70A  d.126.1.3 * 7e-41 35.1 %
:HMM:SCOP  4->254 1rxxA_ d.126.1.4 * 2.3e-53 33.9 %
:RPS:PFM   58->254 PF02274 * Amidinotransf 6e-14 31.5 %
:HMM:PFM   56->190 PF02274 * Amidinotransf 2.4e-26 29.6 135/382  
:HMM:PFM   199->253 PF02274 * Amidinotransf 3.6e-07 29.1 55/382  
:BLT:SWISS 1->257 DDAH_STRCO e-132 87.9 %
:PROS 1->57|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69401.1 GT:GENE ddh GT:PRODUCT putative dimethylarginine dimethylaminohydrolase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2068821..2069597 GB:FROM 2068821 GB:TO 2069597 GB:DIRECTION + GB:GENE ddh GB:PRODUCT putative dimethylarginine dimethylaminohydrolase GB:NOTE PF02274: Amidinotransferase GB:PROTEIN_ID BAC69401.1 LENGTH 258 SQ:AASEQ MPSKKALIRRPSPRLAEGLVTHIERAQVDVGLAVEQWEAYAEALRTHGWETVEVDPADDCPDSVFVEDAVVMYRNVALITRPGADSRRGETAGVEEAVARLGCSVNWIWEPGTLDGGDVLKIGDTIYVGRGGRTNAAGVQQLRAVFEPLGAQVVAVPVSKVLHLKSSVTALPDGTVIGHIPLVDRPALFTRFLSVPEESGSHVVLLGGSKLLMADSAPKTADLLADLGHEPVLVNISEYEKLEGCVTCLSVRLRELYA GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 1->257|DDAH_STRCO|e-132|87.9|257/258| PROS 1->57|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 4->252|1h70A|2e-38|37.1|248/255| RP:PDB:NREP 1 RP:PDB:REP 4->254|2ci3A|3e-50|33.3|249/274| RP:PFM:NREP 1 RP:PFM:REP 58->254|PF02274|6e-14|31.5|197/239|Amidinotransf| HM:PFM:NREP 2 HM:PFM:REP 56->190|PF02274|2.4e-26|29.6|135/382|Amidinotransf| HM:PFM:REP 199->253|PF02274|3.6e-07|29.1|55/382|Amidinotransf| GO:PFM:NREP 2 GO:PFM GO:0005737|"GO:cytoplasm"|PF02274|IPR003198| GO:PFM GO:0016813|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines"|PF02274|IPR003198| RP:SCP:NREP 1 RP:SCP:REP 4->253|1h70A|7e-41|35.1|248/255|d.126.1.3| HM:SCP:REP 4->254|1rxxA_|2.3e-53|33.9|251/412|d.126.1.4|1/1|Pentein| OP:NHOMO 151 OP:NHOMOORG 121 OP:PATTERN 11----------------------------------------------------------1---1--- -11------------1111-11--1-1111111------1----1----111--------1------21----------111---------------------------------------------------------11---12-----------------------------------------------1---------------1---------------------1----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-----1---11--------------1--------------------------------------------------------111111-----11--------1------------------------------1-------------------1---1----------------------------------------------------------------------------------1---------------------------------------------------1-----------------1---------1--------------------1111--------------------------------1111------------------------------------------------------------------------------------------------------------2- ------1-12---------------------------------------------------------------------------------------------1-1-1--J221-1-11-1-1111121121-1111--1--11--11-----1-1111-2-212--111----1-11-------1-----1-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 98.4 SQ:SECSTR #cccEEEEEcccTTHHHHcccccccccccHHHHHHHHHHHHHHHHTTccEEEEEcccTTcTTTTcGGGGEEEETTEEEEcccccGGGTTHHHHHHHHHHHTTcEEEcccTTccccGGGEEEcccEEEEEEcccccHHHHHHHHHHTTTcEcEEEEEEccccccGGGcEEEEETTEEEEEccHHHHHHHHHEEEEEccGGGGccETTTEEEEEETTTcHHHHHHHTTcTcEEEEcccHHHHTTTccGGGGcEEEcc### DISOP:02AL 1-2| PSIPRED ccccEEEEEccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccccEEEccccEEEEcccEEEcccccHHHccHHHHHHHHHHHcccEEEEEccccEEccEEEEEEccEEEEEEcccccHHHHHHHHHHHHHccEEEEEEcccccEEEEEEEEEccccEEEEcHHHHcHHHHccccEEEEccccccEEEEcccEEEEccccHHHHHHHHHcccEEEEEccHHHHHcccccEEEEEEHHEccc //