[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : desA
DDBJ      :desA         putative fatty acid desaturase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->291 1oq9A PDBj 8e-27 32.3 %
:RPS:PDB   32->236 3chhA PDBj 3e-20 9.3 %
:RPS:SCOP  18->284 1za0A1  a.25.1.2 * 5e-24 25.6 %
:HMM:SCOP  10->321 1afrA_ a.25.1.2 * 3.8e-81 36.8 %
:RPS:PFM   19->310 PF03405 * FA_desaturase_2 2e-56 42.3 %
:HMM:PFM   15->319 PF03405 * FA_desaturase_2 1.2e-80 32.3 297/330  
:BLT:SWISS 22->310 STAD_GOSHI 8e-29 32.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69402.1 GT:GENE desA GT:PRODUCT putative fatty acid desaturase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2069818..2070792 GB:FROM 2069818 GB:TO 2070792 GB:DIRECTION + GB:GENE desA GB:PRODUCT putative fatty acid desaturase GB:NOTE PF03405: Fatty acid desaturase GB:PROTEIN_ID BAC69402.1 LENGTH 324 SQ:AASEQ MTITSPHLGSTSDWTDARLLYALEEVVENELNRHLKVAKDWMPHDYVPWSDARNFPGLFEDGEAWDKEQSKVTEIGRIALVVNLLTEDNLPSYHHEIASLFGRDGAWGTWVHRWTAEEGRHGIVMRDYLLASRAVDPDKLEAFRMSHMSEGFESDNRHSMLHSVAYVAFQELATRVSHRNTGHQSGDPVCDRMLARIATDENLHMVFYRNLLKAAFELAPDLTMQAVRDVVVNFRMPGHGIPGFERAAAQMAIGEVYNMRIHHDDVLQPVLRHLKVLEIDGLSPEGLHAQEELGLFMGGLDTEARKFDEKLAARKARMAARAGA GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 22->310|STAD_GOSHI|8e-29|32.7|281/397| SEG 312->323|aarkarmaarag| BL:PDB:NREP 1 BL:PDB:REP 22->291|1oq9A|8e-27|32.3|266/338| RP:PDB:NREP 1 RP:PDB:REP 32->236|3chhA|3e-20|9.3|204/300| RP:PFM:NREP 1 RP:PFM:REP 19->310|PF03405|2e-56|42.3|284/305|FA_desaturase_2| HM:PFM:NREP 1 HM:PFM:REP 15->319|PF03405|1.2e-80|32.3|297/330|FA_desaturase_2| GO:PFM:NREP 3 GO:PFM GO:0006631|"GO:fatty acid metabolic process"|PF03405|IPR005067| GO:PFM GO:0045300|"GO:acyl-[acyl-carrier-protein] desaturase activity"|PF03405|IPR005067| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03405|IPR005067| RP:SCP:NREP 1 RP:SCP:REP 18->284|1za0A1|5e-24|25.6|238/242|a.25.1.2| HM:SCP:REP 10->321|1afrA_|3.8e-81|36.8|304/0|a.25.1.2|1/1|Ferritin-like| OP:NHOMO 164 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ----1---------63422-22223222222333332132-232----------------11-----111-----------------------------1-121---1-1-------------------------------------------------------------------------11----------------1-----1---------1-----1-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--121H111217796-871------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 88.6 SQ:SECSTR ##################HHHTTHHHHHHGGGTTccTTcccccGGGcTTTTcHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTTccTTTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccccccHHTTcccHHHHHHHHHHHHHHHHHcccHHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHTTTTcccHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTTTTccccccHHHHHHHHHHHHHHTccTTHHH################### DISOP:02AL 3-7, 310-324| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccc //