[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : dppA1
DDBJ      :dppA1        putative D-aminopeptidase
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  92/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.99.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->237 1hi9A PDBj 2e-37 37.3 %
:RPS:SCOP  1->276 1hi9A  c.99.1.1 * 8e-20 32.6 %
:HMM:SCOP  1->272 1hi9A_ c.99.1.1 * 6.2e-80 42.4 %
:RPS:PFM   1->245 PF04951 * Peptidase_M55 2e-48 44.9 %
:HMM:PFM   1->246 PF04951 * Peptidase_M55 2.2e-76 42.3 246/265  
:BLT:SWISS 1->237 DPPA_BACSU 9e-37 37.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68821.1 GT:GENE dppA1 GT:PRODUCT putative D-aminopeptidase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1395202..1396032) GB:FROM 1395202 GB:TO 1396032 GB:DIRECTION - GB:GENE dppA1 GB:PRODUCT putative D-aminopeptidase GB:NOTE PF04951: D-aminopeptidase GB:PROTEIN_ID BAC68821.1 LENGTH 276 SQ:AASEQ MRIHISADMEGITGLVGADDVQPGGRDYERGRSMMAEDVNAAVRGAVAAGATDIVVNDAHGPMRNLLPEALHPAARLIRGRPKQMGMLEGLTREHDAMICVGYHARAGALGVLSHSFMGHEIEDMWLDGRPVGEIGLAQATAATLGVPLVALTGDDAACAEATAWDDSITTVPVKYAHDRFAAELRPAAEARQAIEEAVTAALSAVPEAPLVPANPRTLTVRWQSASVASTLLGIPGVTTPDSRTAEAHGELPALYRLFGVWMRVAASLGNQPPYC GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 1->237|DPPA_BACSU|9e-37|37.3|236/100| SEG 41->51|aavrgavaaga| BL:PDB:NREP 1 BL:PDB:REP 1->237|1hi9A|2e-37|37.3|236/274| RP:PFM:NREP 1 RP:PFM:REP 1->245|PF04951|2e-48|44.9|245/265|Peptidase_M55| HM:PFM:NREP 1 HM:PFM:REP 1->246|PF04951|2.2e-76|42.3|246/265|Peptidase_M55| RP:SCP:NREP 1 RP:SCP:REP 1->276|1hi9A|8e-20|32.6|273/274|c.99.1.1| HM:SCP:REP 1->272|1hi9A_|6.2e-80|42.4|271/274|c.99.1.1|1/1|Dipeptide transport protein| OP:NHOMO 110 OP:NHOMOORG 104 OP:PATTERN 111-11------------------------------------------------1111111------- ----2--------------------------------1--------------------------11-211---------------------------------------------------------------------------1--------1----------------------------111-------1---------------1-1111------11--1----12---------------------1----1-----------------------------------------------------------------21-------------1--------------1--1--1--1-1----1--2----------------------------------1--------1-1-----1--------1-----------------------------------------------------------------111-1111111-111111111111-11111111--111--1----1111------------------------1-1-1-------------------------------------------------------------------------------------------------11------------------------------------11---------------------------1--------------------------------------------------------------------------------------------------------------------1------------------------------------------111-1-2------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 85.5 SQ:SECSTR cEEEEEEccTTcTTcccGGGTcTTcTTHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEccTTcccccTTTccTTcEEEcccccTTGGGTTccTTccEEEEEEEcccTTcccTTccc#ccTTEEEEEETTEEEcHHHHHHHHHHHTTccEEEEEEEHHHHHHHHTTcTTcEEEEEEEEEETTEEEccHHHHHHHHHHHHHHHHHcGGGccccccccccEEEEEEccHHHHHHHTTcTT####################################### DISOP:02AL 179-194| PSIPRED cEEEEEEEcccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHccccEEEEEcccccHHHHHHHcccccEEEEEEEEccccccccHHEEEHHHEEEEEEEcccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEEEcccccccEEcccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccHHHHHHHHHcccEEEcccEEEEEEccHHHHHHHHHHHHHHHHHHccccccc //