[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : echA1
DDBJ      :echA1        putative enoyl-CoA hydratase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  391/915 : Eukaryota  133/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->277 3gkbC PDBj e-142 100.0 %
:RPS:PDB   6->237 1ef9A PDBj 8e-29 17.3 %
:RPS:SCOP  9->251 1sg4A1  c.14.1.3 * 2e-31 21.4 %
:HMM:SCOP  6->265 1wdkA4 c.14.1.3 * 4.3e-49 32.0 %
:RPS:PFM   18->191 PF00378 * ECH 3e-05 33.1 %
:HMM:PFM   19->191 PF00378 * ECH 2.7e-32 31.1 167/170  
:BLT:SWISS 5->243 ECHH_RHIME 6e-17 31.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68202.1 GT:GENE echA1 GT:PRODUCT putative enoyl-CoA hydratase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 637423..638256 GB:FROM 637423 GB:TO 638256 GB:DIRECTION + GB:GENE echA1 GB:PRODUCT putative enoyl-CoA hydratase GB:NOTE PF00378: Enoyl-CoA hydratase/isomerase family GB:PROTEIN_ID BAC68202.1 LENGTH 277 SQ:AASEQ MRNDAYSTLRVSSEHGVARIILDNPPVNVIGATMMRELRTVLTTLADDSSVRVIVFSSADPEFFLAHVDMRIGEKMDALQELAASAPADVNVFQAVGELIRHQPQVTIVKLAGKARGGGAEFVAAADMAFAAAETAGLGQIEALMGIIPGGGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKRSLPADDLKEGLLGENDAWAATFSLPAAQQLISGGLKDGAQTPAGERDLEGLMRSVAR GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 5->243|ECHH_RHIME|6e-17|31.4|229/257| SEG 120->136|aefvaaadmafaaaeta| BL:PDB:NREP 1 BL:PDB:REP 3->277|3gkbC|e-142|100.0|275/276| RP:PDB:NREP 1 RP:PDB:REP 6->237|1ef9A|8e-29|17.3|225/261| RP:PFM:NREP 1 RP:PFM:REP 18->191|PF00378|3e-05|33.1|163/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 19->191|PF00378|2.7e-32|31.1|167/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 9->251|1sg4A1|2e-31|21.4|234/249|c.14.1.3| HM:SCP:REP 6->265|1wdkA4|4.3e-49|32.0|256/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 902 OP:NHOMOORG 554 OP:PATTERN 11-1--2432333342--1121142221-113------------------------------11--11 131-21-1---1-131111-12115911111433331-64-2--1--2----1--2----232-2123122---------1-1-----------1-1--1-2112411-1--------------1-1-1--1-12-11113---111-----------1-111---------11----1--1---------121111111-11--112-11---11-12421-2-------2---------------------------------------------------------------------------------------------1131111111212-2---11--2-1-1-11-111314--3---1----1--1112-------3-22-111212233-2-32331---1--2-2212-211-21143121111111-1111-211--------1----1-1------------------------------1221-111-41331322111122211111123332652-1111111122132-4--2----------------2423511-----------152161---12212221-----------------------------1---41---------12------11-21---1---------2111-1-1111111111-1111111111111111111111111-1222122222222221221111111--111111111111---------------2---------1111----222-2-1-123-1111-12111-1--212-----------1-1-----1322211------------------1111------------------------------------------------1 ----211-11--23--111-12111--1111111111211111--112262242121111111---------------------------2-11221---2-2211-2313552334111121-221112A2-221-1-12226--11--22-2-1111221121--211-312-2-11G11-21-1111-1222111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 100.0 SQ:SECSTR TTccccccEEEEEETTEEEEEEccGGTTcccHHHHHHHHHHHHHTccTTccEEEEEccTTccEEEccccGGHHGcccccccTTccccHHHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHHTccEEEEETTcEcEEccGGGTTccccHHHHHTTTTTccHHHHHHHHHHcccEEHHHHHHTTcccEEEcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHcccccHHHHHHHHTccHHHcHHHHHHHHHHHHTTTTcHHHHHTHHHHHHHHHH DISOP:02AL 1-3, 275-277| PSIPRED cccccccEEEEEEEccEEEEEEcccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccEEEcccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccc //