[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : echA5
DDBJ      :echA5        putative enoyl-CoA hydratase
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  665/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->249 2dubD PDBj 3e-40 39.4 %
:RPS:PDB   7->255 1dubB PDBj 2e-50 36.5 %
:RPS:SCOP  17->253 1uiyA  c.14.1.3 * 2e-53 38.6 %
:HMM:SCOP  1->256 1wdkA4 c.14.1.3 * 9.3e-76 45.3 %
:RPS:PFM   18->180 PF00378 * ECH 6e-27 51.9 %
:HMM:PFM   17->179 PF00378 * ECH 2.2e-44 42.9 163/170  
:BLT:SWISS 13->256 CAID_SHIFL 9e-44 44.2 %
:PROS 97->117|PS00166|ENOYL_COA_HYDRATASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69060.1 GT:GENE echA5 GT:PRODUCT putative enoyl-CoA hydratase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1664591..1665361) GB:FROM 1664591 GB:TO 1665361 GB:DIRECTION - GB:GENE echA5 GB:PRODUCT putative enoyl-CoA hydratase GB:NOTE PF00378: Enoyl-CoA hydratase/isomerase family GB:PROTEIN_ID BAC69060.1 LENGTH 256 SQ:AASEQ MHSTTEVRTETIGSSLLITIDRPKARNAVNAAVATQLAFAIDQLEADPALRAAVLTGAQGTFSAGMDLKAALAGESPEIPGRGFGGLTRARTTKPLIAAVEGWAMGGGFELALGCDLIVAADDARFGLPEVGRGLIAAGGGVIRLPKRIPYHLAMELLLTGEPVSGERAGQLGIANRVVAAGETVATALHLAERIAQNAPLALAAVKNLVRAADGAPEEEAFAVQGRLMATLAASADVREGMTAFTERRSPVWQGR GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 13->256|CAID_SHIFL|9e-44|44.2|242/261| PROS 97->117|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| BL:PDB:NREP 1 BL:PDB:REP 17->249|2dubD|3e-40|39.4|231/257| RP:PDB:NREP 1 RP:PDB:REP 7->255|1dubB|2e-50|36.5|249/259| RP:PFM:NREP 1 RP:PFM:REP 18->180|PF00378|6e-27|51.9|162/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 17->179|PF00378|2.2e-44|42.9|163/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 17->253|1uiyA|2e-53|38.6|236/253|c.14.1.3| HM:SCP:REP 1->256|1wdkA4|9.3e-76|45.3|256/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 5710 OP:NHOMOORG 872 OP:PATTERN 33-1--5987988977-121211A52231238-----------------------------2331-11 2556D325113544LcQEE-EU55ReFEFFFPbWdWKShp2V4T2125122265544511AAI1BCLE7D7--------1518-----1111-1211--31222253323--------------11111121112155544---4821131111111111111111-112111111111111154323---7535555544646464443855446645BA85421111119-111111111111111111111-1----1-----11---1-111111---111111111111111111111111111111111-1111112--1231111111212-2221221-211-3-11-561427-15---1--2-2--FBBI-----51ZJM646RGRKG78897786888-54945I5BADR-955476AB9ABA8B8H9ACC478898G--------622-1CD4-----------------------------1DHYC-3hVGPCIJGSD98887DDGGAAA959JDbQhiX23FF8C88BBICKJLU229----65----------LAB5V9C1---------17962F13--4534B633---------------------------671782A49646666656B666686A7679---221-------42351447556765688-587865576756566766655522333454444444444444464545555--333333333333---3232222222-6935222111-11112111CCBAC4B57671CBBB6B89798987556----------1115111114644455566656661-1---11666644-----------------------------------------------11 ----776-743-438AA64A9A9C6BA7769678876C79998878677B8AEC885344442---1------1-111-11---1--1-583A5552322538656-9C7IFD8CB753558B1F84B5LyA-EAC3163A56E61476184-C4698IELF7F964B79AAD8A4542b2546589AG77778A7857 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 100.0 SQ:SECSTR ccccccEEEcGGGcEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEccccEEEccccHHHHTTccHHHHHHTTTTTTGGGGccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHccEEEHHHHHHHTcccEEEcTTTHHHHHHHHHHHHHTccHHHHHHHHHHHHGGGTccHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTTcccccccH DISOP:02AL 253-256| PSIPRED cccccEEEEEEEccEEEEEEccHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccccHHHHccccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //