[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : echA6
DDBJ      :echA6        putative enoyl-CoA hydratase
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  640/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->243 1mj3A PDBj 2e-26 30.6 %
:RPS:PDB   6->244 1dubA PDBj 7e-41 29.3 %
:RPS:SCOP  10->244 1dubA  c.14.1.3 * 2e-43 29.8 %
:HMM:SCOP  1->246 1wdkA4 c.14.1.3 * 9.3e-68 41.1 %
:RPS:PFM   14->177 PF00378 * ECH 2e-26 43.3 %
:HMM:PFM   15->178 PF00378 * ECH 4.6e-38 40.2 164/170  
:HMM:PFM   191->227 PF08624 * CRC_subunit 0.00031 32.4 37/139  
:BLT:SWISS 13->245 ECHM_DICDI 6e-27 32.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69376.1 GT:GENE echA6 GT:PRODUCT putative enoyl-CoA hydratase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 2037350..2038099 GB:FROM 2037350 GB:TO 2038099 GB:DIRECTION + GB:GENE echA6 GB:PRODUCT putative enoyl-CoA hydratase GB:NOTE PF00378: Enoyl-CoA hydratase/isomerase family GB:PROTEIN_ID BAC69376.1 LENGTH 249 SQ:AASEQ MEPQLLHSVADGVATVVIHHPAKRNAMTAGMWRALPSLLDELASDTAVNALVLTGQGDTFCAGADISTLLDSPDEAQALAARAEESLAAFPKPTLAAVRGYCVGGGSQLAAACDLRFAEAGSLFGVTPAKLGIVYPASATRRLVSLVGPATAKYLLFSGELIDAERALRTGFVDEVLPEGQLDKRVAEFTRVLTARSQLTQAAAKEFANGRADRDTYWAQQARGSGDTAEGVAAFLEHRRPRFTWTTSG GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 13->245|ECHM_DICDI|6e-27|32.8|229/277| SEG 75->89|eaqalaaraeeslaa| BL:PDB:NREP 1 BL:PDB:REP 13->243|1mj3A|2e-26|30.6|229/258| RP:PDB:NREP 1 RP:PDB:REP 6->244|1dubA|7e-41|29.3|239/260| RP:PFM:NREP 1 RP:PFM:REP 14->177|PF00378|2e-26|43.3|164/170|ECH| HM:PFM:NREP 2 HM:PFM:REP 15->178|PF00378|4.6e-38|40.2|164/170|ECH| HM:PFM:REP 191->227|PF08624|0.00031|32.4|37/139|CRC_subunit| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 10->244|1dubA|2e-43|29.8|235/260|c.14.1.3| HM:SCP:REP 1->246|1wdkA4|9.3e-68|41.1|246/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 4462 OP:NHOMOORG 838 OP:PATTERN 22-1--5987988875-121211962231237-----------------------------2331-11 1445B224112544KTL99-9H44JUA9AAAIQNQNEKcf1I3J1-14-1224354241189G19CFA694--------141A-----1111-1211--31322353213--------------11111121112144443---4711111111111111111111-112111111111111133323---6534444444546454442844335644BA84411111118-111111111111111111111-1----1-----11---1-111111---111-1-------------1111111111111----11------1231111111212-2221221-211-3-11-561416-15---1--1-2-1988E-----4-NAD425JDIDA45564453554-11611D187BN-7332245968A7787B6777357765D--------722-1A84-----------------------------1AFQ7-3ZOCL9CDDL95666588CC888746DAXOZZR23DD7764A9H8HCIO328----65----------EA83R981---------16862D13--4534A432---------------------------461471645435555545855558587577---211-------42241236445654577-476754465645455655544422234454444444444444443424444--322222222222---1232221112-2723222111-11112111998791757541AAA95967587888445----------111411111462445544443444------11776644-----------------------------------------------11 ----644-432-4376532766784854534343543855555635466877C85712211131-------------------------3425332122-315544-8C5JBA67A763445B1D83A3Lt9-C9D3254A46A82565-852B4596FAC97F764A49A8B793432V24335733C5364585557 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 98.4 SQ:SECSTR ccccEEEcGGGcEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEccccEEEccccHHHHTTccHHHHTTTTTTTTGGGGccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcTTTHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTTccccccc#### DISOP:02AL 244-249| PSIPRED cccEEEEEEEccEEEEEEccHHHcccccHHHHHHHHHHHHHHHcccccEEEEEEcccccEEccHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccEEcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccc //