[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fabC2
DDBJ      :fabC2        putative acyl carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->73 2qnwA PDBj 7e-06 30.9 %
:RPS:PDB   1->74 3ejbA PDBj 7e-08 24.3 %
:RPS:SCOP  8->77 1af8A  a.28.1.1 * 1e-06 22.9 %
:HMM:SCOP  1->76 1klpA_ a.28.1.1 * 3e-13 27.6 %
:HMM:PFM   6->72 PF00550 * PP-binding 8.4e-13 32.8 67/67  
:BLT:SWISS 1->77 ACP_RHILO 1e-07 33.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68318.1 GT:GENE fabC2 GT:PRODUCT putative acyl carrier protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(762046..762285) GB:FROM 762046 GB:TO 762285 GB:DIRECTION - GB:GENE fabC2 GB:PRODUCT putative acyl carrier protein GB:NOTE nrps6 gene cluster, PF00550: Phosphopantetheine attachment site GB:PROTEIN_ID BAC68318.1 LENGTH 79 SQ:AASEQ MSTTYDRLVDILARLHDAPADRIRPEATLGELDVDSLTTVEISIRIERDLGVAVGDDELQPDLTLGDLAGLVDARQATV GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 1->77|ACP_RHILO|1e-07|33.8|77/78| BL:PDB:NREP 1 BL:PDB:REP 6->73|2qnwA|7e-06|30.9|68/80| RP:PDB:NREP 1 RP:PDB:REP 1->74|3ejbA|7e-08|24.3|74/78| HM:PFM:NREP 1 HM:PFM:REP 6->72|PF00550|8.4e-13|32.8|67/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 8->77|1af8A|1e-06|22.9|70/86|a.28.1.1| HM:SCP:REP 1->76|1klpA_|3e-13|27.6|76/115|a.28.1.1|1/1|ACP-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 98.7 SQ:SECSTR cccHHHHHHHHHHHHccccTTTccTTccTTTTcccTTHHHHHHHHHHHHTTccccHHHHHHcccHHHHHHHHHHHHHc# DISOP:02AL 78-79| PSIPRED cHHHHHHHHHHHHHHHcccHHHccccccHHHHcccHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHcccc //