[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fabC4
DDBJ      :fabC4        putative acyl carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->76 2amwA PDBj 2e-05 21.9 %
:RPS:SCOP  2->59 1vkuA  a.28.1.1 * 1e-05 17.9 %
:HMM:SCOP  1->80 1dv5A_ a.28.1.3 * 2.4e-08 25.6 %
:HMM:PFM   9->76 PF00550 * PP-binding 1.3e-09 35.9 64/67  
:BLT:SWISS 2->66 ACP_SULNB 1e-05 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67926.1 GT:GENE fabC4 GT:PRODUCT putative acyl carrier protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 255013..255273 GB:FROM 255013 GB:TO 255273 GB:DIRECTION + GB:GENE fabC4 GB:PRODUCT putative acyl carrier protein GB:NOTE PF00550: Phosphopantetheine attachment site GB:PROTEIN_ID BAC67926.1 LENGTH 86 SQ:AASEQ MDDITSVVIDFLAEYEGVSPGELRSELEQDGRELPVDSLLVVEILTRIEERYHVAIPADREAAQATGSVRAFAAAVLDAIEERQQS GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 2->66|ACP_SULNB|1e-05|40.0|60/75| RP:PDB:NREP 1 RP:PDB:REP 2->76|2amwA|2e-05|21.9|73/83| HM:PFM:NREP 1 HM:PFM:REP 9->76|PF00550|1.3e-09|35.9|64/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 2->59|1vkuA|1e-05|17.9|56/85|a.28.1.1| HM:SCP:REP 1->80|1dv5A_|2.4e-08|25.6|78/80|a.28.1.3|1/1|ACP-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 95.3 SQ:SECSTR cHHHHHHHHHHTTcGGGGGcccT#cTcccTTTcTTTTHHHHHHHHHHHHHHTTccccTTTccGGGcccHHHHHHHHHHHHHHc### DISOP:02AL 1-2, 24-30, 83-86| PSIPRED ccHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //