[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : fabH5
DDBJ      :fabH5        putative 3-oxoacyl-ACP synthase III
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  497/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->316 3il5B PDBj 4e-15 26.1 %
:RPS:PDB   8->317 1b65A PDBj 8e-21 12.1 %
:RPS:SCOP  6->171 1eblA1  c.95.1.2 * 1e-13 24.2 %
:RPS:SCOP  215->336 1u0mA2  c.95.1.2 * 2e-15 17.4 %
:HMM:SCOP  1->337 1tedA_ c.95.1.2 * 1.5e-28 21.9 %
:RPS:PFM   248->317 PF08541 * ACP_syn_III_C 7e-10 37.1 %
:HMM:PFM   245->334 PF08541 * ACP_syn_III_C 4.3e-25 37.1 89/90  
:HMM:PFM   114->188 PF08545 * ACP_syn_III 6.7e-11 26.8 71/80  
:BLT:SWISS 44->317 FABH_POLSJ 8e-24 31.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC69084.1 GT:GENE fabH5 GT:PRODUCT putative 3-oxoacyl-ACP synthase III GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1692037..1693056 GB:FROM 1692037 GB:TO 1693056 GB:DIRECTION + GB:GENE fabH5 GB:PRODUCT putative 3-oxoacyl-ACP synthase III GB:NOTE PF08541: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal GB:PROTEIN_ID BAC69084.1 LENGTH 339 SQ:AASEQ MTTVSLTDVASYLPGEPVPAEFYTDYPGAEDKLRNHPMFKVPPSRHHVAADESNADMVERAVQPLIERHGRDEIRGVDVLLVHSQLPDLPFVGAGTEVARRLGLNPEWLVDVANAGCASFVYMLKLARQILTTTDAKTALICNAQSAAGQCFTQSEVRRLAQAAIPGDGCGVGYVTTSADTPVLDVETRHIGEYAGDMTVAVDDGRKYWEPGESQLRIGFTDASVAKVLARGNRLVPEVVTDLCRRLGVATADIDVLITNQPNRTFLRNWREALQLPPERHLNTFDQYGNLFGAAIPITLDRAIRSRQVEDGDLVVLGGFAHAGDFAGATAVRWHGGRG GT:EXON 1|1-339:0| BL:SWS:NREP 1 BL:SWS:REP 44->317|FABH_POLSJ|8e-24|31.3|252/325| SEG 318->331|ggfahagdfagata| BL:PDB:NREP 1 BL:PDB:REP 44->316|3il5B|4e-15|26.1|253/319| RP:PDB:NREP 1 RP:PDB:REP 8->317|1b65A|8e-21|12.1|290/363| RP:PFM:NREP 1 RP:PFM:REP 248->317|PF08541|7e-10|37.1|70/90|ACP_syn_III_C| HM:PFM:NREP 2 HM:PFM:REP 245->334|PF08541|4.3e-25|37.1|89/90|ACP_syn_III_C| HM:PFM:REP 114->188|PF08545|6.7e-11|26.8|71/80|ACP_syn_III| GO:PFM:NREP 2 GO:PFM GO:0008610|"GO:lipid biosynthetic process"|PF08541|IPR013747| GO:PFM GO:0016747|"GO:transferase activity, transferring acyl groups other than amino-acyl groups"|PF08541|IPR013747| RP:SCP:NREP 2 RP:SCP:REP 6->171|1eblA1|1e-13|24.2|157/174|c.95.1.2| RP:SCP:REP 215->336|1u0mA2|2e-15|17.4|121/148|c.95.1.2| HM:SCP:REP 1->337|1tedA_|1.5e-28|21.9|320/0|c.95.1.2|1/1|Thiolase-like| OP:NHOMO 544 OP:NHOMOORG 507 OP:PATTERN -------------------------------------------------------------------- 112-----------111--------1------11111-11--2-----------------1-----21---------------1-1------11--1--111112-11-1---------------1-1--------111------1---11111-11-1--11111-112111-11-1111-1--1--1--1-2--------21---1-111111----1----111111121111111111111111121-11-1------1-------121--1-1111111-1--------------1111111111111211---111-1---1------1--111--1111--1--1-1--111-1-121---11----121---1111111111111111-11111111111--111111111-1----1--1------111----1-11111111111111111111----1--------1----1--1-11-------111--111111121221111111111111111211111-11-11111111111111-1111-1111111111-11111-1---1-1---11121112112222-3--11111111111-11-1--1111-1111221-1--1111-111111-1111--111-1--11111------111-11-1111111111-11111111111111111111-11111-1111111111111111111111111--------------1111111112221----1111--1--1-1111--------------------------11-1--------111111111132-111-111111111111111--------------------------------------------1--------121 ------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------1---11114--1-1--1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 317 STR:RPRED 93.5 SQ:SECSTR cccEEEEGGTccccccccTTccGGGcTTcEEEHHHEEEEEccccTTcccccEEEEEEEETTTTccccccEccGEEEEEEEEEccccccHHHHHHHcEEcccEEEEEGGGHHHHccHHHHHHHHHHHTHHHHccccccccccEEEEEccTTTccGGGTTTccccHHHHHHHHHTccccEEEEEEEcccccccGGGTTcEETTEEcEEEEEHTEEEEEETTEEEEEEEEEEEccccGGGcccTTccHHHHcHHHHccEEEEEEEcccccHHHHHHHHHTHHHHHHTTTccccTTcEEEEEEEEccccccGGGccccccc###################### DISOP:02AL 338-339| PSIPRED ccEEEEEEEEEEcccccccHHHHHHHHccccHHHHccEEEccEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHccEEEEEEcccccccccHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHcccccccccHHHHHHHHHHcccEEEEEEEEcccccEEEEEEEcccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccEEEEccccHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccEEEEEEEcHHHHHHHEEEEEEccccc //